Western Blot (WB)
(Western Blot analysis of TXNL4B expression in transfected 293T cell line by TXNL4B polyclonal antibody. Lane 1: TXNL4B transfected lysate (16.39kD). Lane 2: Non-transfected lysate.)
Mouse anti-Human TXNL4B Polyclonal Antibody | anti-TXNL4B antibody
TXNL4B (Thioredoxin-like Protein 4B, Dim1-like Protein, DLP, DIM2)
Gene Names
TXNL4B; DLP; Dim2
Reactivity
Human
Applications
Western Blot, Immunofluorescence
Purity
Affinity PurifiedPurified by Protein A affinity chromatography.
Synonyms
TXNL4B; Polyclonal Antibody; TXNL4B (Thioredoxin-like Protein 4B; Dim1-like Protein; DLP; DIM2); Anti -TXNL4B (Thioredoxin-like Protein 4B; anti-TXNL4B antibody
Host
Mouse
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human TXNL4B.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
MSFLLPKLTSKKEVDQAIKSTAEKVLVLRFGRDEDPVCLQLDDILSKTSSDLSKMAAIYLVDVDQTAVYTQYFDISYIPSTVFFFNGQHMKVDYGSPDHTKFVGSFKTKQDFIDLIEVIYRGAMRGKLIVQSPIDPKNIPKYDLLYQDI
Applicable Applications for anti-TXNL4B antibody
Western Blot (WB), Immunofluorescence (IF)
Application Notes
Suitable for use in Immunofluorescence and Western Blot.
Dilution: Immunofluorescence: 10ug/ml
Dilution: Immunofluorescence: 10ug/ml
Immunogen
Full length human TXNL4B, aa1-149 (NP_060323.1).
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Western Blot (WB)
(Western Blot analysis of TXNL4B expression in transfected 293T cell line by TXNL4B polyclonal antibody. Lane 1: TXNL4B transfected lysate (16.39kD). Lane 2: Non-transfected lysate.)
Western Blot (WB)
(Western Blot analysis of TXNL4B expression in transfected 293T cell line by TXNL4B polyclonal antibody. Lane 1: TXNL4B transfected lysate (16.39kD). Lane 2: Non-transfected lysate.)
Immunofluorescence (IF)
(Immunofluorescence of purified antibody to TXNL4B on HeLa cell. [antibody concentration 10ug/ml].)
Immunofluorescence (IF)
(Immunofluorescence of purified antibody to TXNL4B on HeLa cell. [antibody concentration 10ug/ml].)
Product Categories/Family for anti-TXNL4B antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
17,015 Da
NCBI Official Full Name
thioredoxin-like protein 4B
NCBI Official Synonym Full Names
thioredoxin-like 4B
NCBI Official Symbol
TXNL4B
NCBI Official Synonym Symbols
DLP; Dim2
NCBI Protein Information
thioredoxin-like protein 4B; Dim1-like protein
UniProt Protein Name
Thioredoxin-like protein 4B
Protein Family
UniProt Gene Name
TXNL4B
UniProt Synonym Gene Names
DIM2; DLP
UniProt Entry Name
TXN4B_HUMAN
Uniprot Description
Function: Essential role in pre-mRNA splicing. Required in cell cycle progression for S/G2 transition. Ref.1
Subunit structure: Homodimer. Interacts with the U5-102 kDa protein subunit of the spliceosome. Ref.7
Subcellular location: Nucleus Ref.1.
Sequence similarities: Belongs to the DIM1 family.
Research Articles on TXNL4B
Similar Products
Product Notes
The TXNL4B txnl4b (Catalog #AAA649383) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The TXNL4B (Thioredoxin-like Protein 4B, Dim1-like Protein, DLP, DIM2) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's TXNL4B can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB), Immunofluorescence (IF). Suitable for use in Immunofluorescence and Western Blot. Dilution: Immunofluorescence: 10ug/ml. Researchers should empirically determine the suitability of the TXNL4B txnl4b for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MSFLLPKLTS KKEVDQAIKS TAEKVLVLRF GRDEDPVCLQ LDDILSKTSS DLSKMAAIYL VDVDQTAVYT QYFDISYIPS TVFFFNGQHM KVDYGSPDHT KFVGSFKTKQ DFIDLIEVIY RGAMRGKLIV QSPIDPKNIP KYDLLYQDI. It is sometimes possible for the material contained within the vial of "TXNL4B, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
