Immunohistochemistry (IHC)
(Rabbit Anti-TUSC4 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Adult LiverObserved Staining: Cytoplasm in hepatocytes, moderate signal, very low tissue distributionPrimary Antibody Concentration: 1:100Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 secProtocol located in Reviews and Data.)
Rabbit TUSC4 Polyclonal Antibody | anti-NPRL2 antibody
TUSC4 antibody - N-terminal region
Gene Names
NPRL2; NPR2; NPR2L; TUSC4; FFEVF2
Reactivity
Cow, Dog, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Immunohistochemistry, Western Blot
Purity
Affinity Purified
Synonyms
TUSC4; Polyclonal Antibody; TUSC4 antibody - N-terminal region; anti-NPRL2 antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MGSGCRIECIFFSEFHPTLGPKITYQVPEDFISRELFDTVQVYIITKPEL
Sequence Length
380
Applicable Applications for anti-NPRL2 antibody
Immunohistochemistry (IHC), Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human TUSC4
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Immunohistochemistry (IHC)
(Rabbit Anti-TUSC4 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Adult LiverObserved Staining: Cytoplasm in hepatocytes, moderate signal, very low tissue distributionPrimary Antibody Concentration: 1:100Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 secProtocol located in Reviews and Data.)
Immunohistochemistry (IHC)
(Rabbit Anti-TUSC4 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Adult LiverObserved Staining: Cytoplasm in hepatocytes, moderate signal, very low tissue distributionPrimary Antibody Concentration: 1:100Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 secProtocol located in Reviews and Data.)
Western Blot (WB)
(WB Suggested Anti-TUSC4 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: OVCAR-3 cell lysateNPRL2 is supported by BioGPS gene expression data to be expressed in OVCAR3)
Western Blot (WB)
(WB Suggested Anti-TUSC4 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: OVCAR-3 cell lysateNPRL2 is supported by BioGPS gene expression data to be expressed in OVCAR3)
Related Product Information for anti-NPRL2 antibody
This is a rabbit polyclonal antibody against TUSC4. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: TUSC4 suppresses Src-dependent tyrosine phosphorylation and activation of PDPK1 and its downstream signaling. TUSC4 down-regulates PDPK1 kinase activity by interfering with tyrosine phosphorylation at the Tyr-9 Tyr-373 and Tyr-376 residues. TUSC4 may act as a tumor suppressor. TUSC4 suppresses cell growth and enhanced sensitivity to various anticancer drugs.
Target Description: TUSC4 suppresses Src-dependent tyrosine phosphorylation and activation of PDPK1 and its downstream signaling. TUSC4 down-regulates PDPK1 kinase activity by interfering with tyrosine phosphorylation at the Tyr-9 Tyr-373 and Tyr-376 residues. TUSC4 may act as a tumor suppressor. TUSC4 suppresses cell growth and enhanced sensitivity to various anticancer drugs.
Product Categories/Family for anti-NPRL2 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
44kDa
NCBI Official Full Name
GATOR complex protein NPRL2
NCBI Official Synonym Full Names
NPR2 like, GATOR1 complex subunit
NCBI Official Symbol
NPRL2
NCBI Official Synonym Symbols
NPR2; NPR2L; TUSC4; FFEVF2
NCBI Protein Information
GATOR complex protein NPRL2
UniProt Protein Name
Nitrogen permease regulator 2-like protein
Protein Family
UniProt Gene Name
NPRL2
UniProt Synonym Gene Names
TUSC4; NPR2-like protein; G21 protein
UniProt Entry Name
NPRL2_HUMAN
Research Articles on NPRL2
Similar Products
Product Notes
The NPRL2 nprl2 (Catalog #AAA3209983) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TUSC4 antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's TUSC4 can be used in a range of immunoassay formats including, but not limited to, Immunohistochemistry (IHC), Western Blot (WB). Researchers should empirically determine the suitability of the NPRL2 nprl2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MGSGCRIECI FFSEFHPTLG PKITYQVPED FISRELFDTV QVYIITKPEL. It is sometimes possible for the material contained within the vial of "TUSC4, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
