Western Blot (WB)
(Host: RabbitTarget Name: TUBB6Sample Tissue: Human Hela Whole Cell lysatesAntibody Dilution: 1ug/ml)
Rabbit anti-Human TUBB6 Polyclonal Antibody | anti-TUBB6 antibody
TUBB6 Antibody - C-terminal region
Gene Names
TUBB6; FPVEPD; TUBB-5; HsT1601
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
TUBB6; Polyclonal Antibody; TUBB6 Antibody - C-terminal region; anti-TUBB6 antibody
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: KAFLHWFTGEGMDEMEFTEAESNMNDLVSEYQQYQDATANDGEEAFEDEE
Sequence Length
446
Applicable Applications for anti-TUBB6 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human TUBB6
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(Host: RabbitTarget Name: TUBB6Sample Tissue: Human Hela Whole Cell lysatesAntibody Dilution: 1ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: TUBB6Sample Tissue: Human Hela Whole Cell lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-TUBB6 antibody
Tubulin is the major constituent of microtubules. It binds two moles of GTP, one at an exchangeable site on the beta chain and one at a non-exchangeable site on the alpha chain
Product Categories/Family for anti-TUBB6 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
50 kDa
NCBI Official Full Name
tubulin beta-6 chain isoform 1
NCBI Official Synonym Full Names
tubulin beta 6 class V
NCBI Official Symbol
TUBB6
NCBI Official Synonym Symbols
FPVEPD; TUBB-5; HsT1601
NCBI Protein Information
tubulin beta-6 chain
UniProt Protein Name
Tubulin beta-6 chain
Protein Family
UniProt Gene Name
TUBB6
UniProt Entry Name
TBB6_HUMAN
Uniprot Description
TUBB6: Tubulin is the major constituent of microtubules. It binds two moles of GTP, one at an exchangeable site on the beta chain and one at a non-exchangeable site on the alpha-chain. Belongs to the tubulin family.
Protein type: Cytoskeletal
Chromosomal Location of Human Ortholog: 18p11.21
Cellular Component: microtubule; cytoplasm; nucleus
Molecular Function: GTPase activity; GTP binding; structural constituent of cytoskeleton
Biological Process: protein polymerization; 'de novo' posttranslational protein folding; cellular protein metabolic process; protein folding; transmembrane transport; microtubule-based process
Research Articles on TUBB6
Similar Products
Product Notes
The TUBB6 tubb6 (Catalog #AAA3222802) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TUBB6 Antibody - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's TUBB6 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the TUBB6 tubb6 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: KAFLHWFTGE GMDEMEFTEA ESNMNDLVSE YQQYQDATAN DGEEAFEDEE. It is sometimes possible for the material contained within the vial of "TUBB6, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
