Mouse anti-Human HNMT Monoclonal Antibody | anti-HNMT antibody

HNMT (Histamine N-methyltransferase, HMT) (FITC)

Cat. Num. AAA6147615

• Gene Names: HNMT; HMT; MRT51; HNMT-S1; HNMT-S2
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: HNMT; Monoclonal Antibody; HNMT (Histamine N-methyltransferase; HMT) (FITC); anti-HNMT antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2b,k
• Clone Number: 3G12
• Specificity: Recognizes human HNMT.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).

• Applicable Applications for anti-HNMT antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa184-292 from human HNMT (NP_008826) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: KKYGSRFPQDDLCQYITSDDLTQMLDNLGLKYECYDLLSTMDISDCFIDGNENGDLLWDFLTETCNFNATAPPDLRAELGKDLQEPEFSAKKEGKVLFNNTLSFIVIEA
• Conjugate: FITC
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.73D))

Western Blot (WB)

(HNMT monoclonal antibody Western Blot analysis of HNMT expression in HeLa.)

Testing Data

(Detection limit for recombinant GST tagged HNMT is ~0.1ng/ml as a capture antibody.)

Product Categories/Family for anti-HNMT antibody

Antibodies; Enzymes; Methyltransferase

NCBI and Uniprot Product Information

• NCBI GI #: 5901970
• NCBI GeneID: 3176
• NCBI Accession #: NP_008826
• NCBI GenBank Nucleotide #: NM_006895
• UniProt Accession #: P50135; Q546Z6; Q7Z7I2; Q8IU56; Q8WW98; Q9BRW6; B2R9J3
• Molecular Weight: 37.4 kDa (328aa) confirmed by MALDI-TOF
• NCBI Official Full Name: histamine N-methyltransferase isoform 1
• NCBI Official Synonym Full Names: histamine N-methyltransferase
• NCBI Official Symbol: HNMT
• NCBI Official Synonym Symbols: HMT; MRT51; HNMT-S1; HNMT-S2
• NCBI Protein Information: histamine N-methyltransferase
• UniProt Protein Name: Histamine N-methyltransferase
• Protein Family: Histamine N-methyltransferase
• UniProt Gene Name: HNMT
• UniProt Synonym Gene Names: HMT
• UniProt Entry Name: HNMT_HUMAN

NCBI Description

In mammals, histamine is metabolized by two major pathways: N(tau)-methylation via histamine N-methyltransferase and oxidative deamination via diamine oxidase. This gene encodes the first enzyme which is found in the cytosol and uses S-adenosyl-L-methionine as the methyl donor. In the mammalian brain, the neurotransmitter activity of histamine is controlled by N(tau)-methylation as diamine oxidase is not found in the central nervous system. A common genetic polymorphism affects the activity levels of this gene product in red blood cells. Multiple alternatively spliced transcript variants that encode different proteins have been found for this gene. [provided by RefSeq, Jul 2008]

Uniprot Description

HNMT: Inactivates histamine by N-methylation. Plays an important role in degrading histamine and in regulating the airway response to histamine. Belongs to the methyltransferase superfamily. HNMT family. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: EC 2.1.1.8; Amino Acid Metabolism - histidine; Methyltransferase

Chromosomal Location of Human Ortholog: 2q22.1

Cellular Component: nucleoplasm; neuron projection; cytoplasm

Molecular Function: histamine N-methyltransferase activity

Biological Process: methylation; hyperosmotic response; response to tumor cell; response to glucocorticoid stimulus; respiratory gaseous exchange; brain development; response to cocaine; response to amine stimulus

Disease: Asthma, Susceptibility To