Mouse anti-Human TUBB4Q Polyclonal Antibody | anti-TUBB8 antibody

TUBB4Q (Beta-tubulin 4Q, Tubulin beta 7 Pseudogene, TUBB7P)

Cat. Num. AAA649172

• Gene Names: TUBB8; bA631M21.2; RP11-631M21.2
• Reactivity: Human
• Applications: Western Blot, Immunofluorescence
• Purity: Affinity Purified; Purified by Protein A affinity chromatography.
• Synonyms: TUBB4Q; Polyclonal Antibody; TUBB4Q (Beta-tubulin 4Q; Tubulin beta 7 Pseudogene; TUBB7P); Anti -TUBB4Q (Beta-tubulin 4Q; anti-TUBB8 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Polyclonal
• Isotype: IgG
• Specificity: Recognizes human TUBB4Q.
• Purity/Purification: Affinity Purified; Purified by Protein A affinity chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2.
• Sequence: MRELVLTQTGQCGNQIGAKFWEVISDEHAIDSAGTYHGDSHLQLERINVHHHEASGGRYVSRAVLVDLEPGTMDSVRSGPFGQVFRPDNFISRQCGAGNNWAKGRYTEGAELTESVMDVVRKEAESCDCLQGFQLTHSLGGGTGSGMGTLLISKIWEEYPDRIINTLSILLLPKVSDTVVEPYNATLSVHQLIENADETFCIDNEALYDICSRTLKLPTPTYGDLNHLVSATMSGVTTCLCFPDQLNADLRKLAMNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVAELTQQMFDAKNMMAARDPRHGRYLTAAAIFQGRMPMREVDEQMFNIQDKNSSYFADWFPNNVKTAVCDIPPWGLKMSVTFTGNNTAVQELKRVSEQFTATFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATAEGGGV

• Applicable Applications for anti-TUBB8 antibody: Western Blot (WB), Immunofluorescence (IF)
• Application Notes: Suitable for use in Immunofluorescence and Western Blot.; Dilution: Immunofluorescence: 10ug/ml
• Immunogen: Full length human TUBB4Q, aa1-434 (AAI46476.1).
• Preparation and Storage: May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(TUBB4Q polyclonal antibody. Western Blot analysis of TUBB4Q expression in human placenta.)

Western Blot (WB)

(TUBB4Q polyclonal antibody. Western Blot analysis of TUBB4Q expression in HeLa.)

Western Blot (WB)

(Western Blot analysis of TUBB4Q expression in transfected 293T cell line by TUBB4Q polyclonal antibody. Lane 1: TUBB4Q transfected lysate (47.74kD). Lane 2: Non-transfected lysate.)

Immunofluorescence (IF)

(Immunofluorescence of purified antibody to TUBB4Q on HeLa cell. [antibody concentration 10ug/ml].)

Product Categories/Family for anti-TUBB8 antibody

Antibodies; Abs to Tubulin

NCBI and Uniprot Product Information

• NCBI GI #: 42558279
• NCBI GeneID: 347688
• NCBI Accession #: NP_817124.1
• NCBI GenBank Nucleotide #: NM_177987.2
• UniProt Accession #: Q3ZCM7; Q5SQX9; Q8WZ78
• Molecular Weight: 49,776 Da
• NCBI Official Full Name: tubulin beta-8 chain isoform 1
• NCBI Official Synonym Full Names: tubulin, beta 8 class VIII
• NCBI Official Symbol: TUBB8
• NCBI Official Synonym Symbols: bA631M21.2; RP11-631M21.2
• NCBI Protein Information: tubulin beta-8 chain; class VIII beta-tubulin; HSA10p15 beta-tubulin 4Q
• UniProt Protein Name: Tubulin beta-8 chain
• Protein Family: Tubulin
• UniProt Gene Name: TUBB8
• UniProt Entry Name: TBB8_HUMAN

Uniprot Description

Function: Tubulin is the major constituent of microtubules. It binds two moles of GTP, one at an exchangeable site on the beta chain and one at a non-exchangeable site on the alpha chain

By similarity.

Subunit structure: Dimer of alpha and beta chains

By similarity.

Subcellular location: Cytoplasm › cytoskeleton

By similarity.

Post-translational modification: Some glutamate residues at the C-terminus are polyglutamylated. This modification occurs exclusively on glutamate residues and results in polyglutamate chains on the gamma-carboxyl group. Also monoglycylated but not polyglycylated due to the absence of functional TTLL10 in human. Monoglycylation is mainly limited to tubulin incorporated into axonemes (cilia and flagella) whereas glutamylation is prevalent in neuronal cells, centrioles, axonemes, and the mitotic spindle. Both modifications can coexist on the same protein on adjacent residues, and lowering glycylation levels increases polyglutamylation, and reciprocally. The precise function of such modifications is still unclear but they regulate the assembly and dynamics of axonemal microtubules

Probable.

Sequence similarities: Belongs to the tubulin family.

Sequence caution: The sequence CAI16221.1 differs from that shown. Reason: Erroneous gene model prediction.