Immunoprecipitation (IP)
(Immunoprecipitation of TUBB4Q transfected lysate using TUBB4Q rabbit polyclonal antibody and Protein A Magnetic Bead and immunoblotted with TUBB4Q mouse polyclonal antibody.)
Rabbit anti-Human TUBB4Q Polyclonal Antibody | anti-TUBB8 antibody
TUBB4Q (Beta-tubulin 4Q, Tubulin beta 7 Pseudogene, TUBB7P)
Gene Names
TUBB8; bA631M21.2; RP11-631M21.2
Reactivity
Human
Applications
Immunoprecipitation
Purity
SerumSerum
Synonyms
TUBB4Q; Polyclonal Antibody; TUBB4Q (Beta-tubulin 4Q; Tubulin beta 7 Pseudogene; TUBB7P); Anti -TUBB4Q (Beta-tubulin 4Q; anti-TUBB8 antibody
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human TUBB4Q.
Purity/Purification
Serum
Serum
Serum
Form/Format
Supplied as a liquid.
Sequence
MRELVLTQTGQCGNQIGAKFWEVISDEHAIDSAGTYHGDSHLQLERINVHHHEASGGRYVSRAVLVDLEPGTMDSVRSGPFGQVFRPDNFISRQCGAGNNWAKGRYTEGAELTESVMDVVRKEAESCDCLQGFQLTHSLGGGTGSGMGTLLISKIWEEYPDRIINTLSILLLPKVSDTVVEPYNATLSVHQLIENADETFCIDNEALYDICSRTLKLPTPTYGDLNHLVSATMSGVTTCLCFPDQLNADLRKLAMNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVAELTQQMFDAKNMMAARDPRHGRYLTAAAIFQGRMPMREVDEQMFNIQDKNSSYFADWFPNNVKTAVCDIPPWGLKMSVTFTGNNTAVQELKRVSEQFTATFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATAEGGGV
Applicable Applications for anti-TUBB8 antibody
Immunoprecipitation (IP)
Application Notes
Suitable for use in Immunoprecipitation.
Immunogen
Full length human TUBB4Q, aa1-434 (AAI46476.1).
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Immunoprecipitation (IP)
(Immunoprecipitation of TUBB4Q transfected lysate using TUBB4Q rabbit polyclonal antibody and Protein A Magnetic Bead and immunoblotted with TUBB4Q mouse polyclonal antibody.)
Immunoprecipitation (IP)
(Immunoprecipitation of TUBB4Q transfected lysate using TUBB4Q rabbit polyclonal antibody and Protein A Magnetic Bead and immunoblotted with TUBB4Q mouse polyclonal antibody.)
Product Categories/Family for anti-TUBB8 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
49,776 Da
NCBI Official Full Name
tubulin beta-8 chain isoform 1
NCBI Official Synonym Full Names
tubulin, beta 8 class VIII
NCBI Official Symbol
TUBB8
NCBI Official Synonym Symbols
bA631M21.2; RP11-631M21.2
NCBI Protein Information
tubulin beta-8 chain; class VIII beta-tubulin; HSA10p15 beta-tubulin 4Q
UniProt Protein Name
Tubulin beta-8 chain
Protein Family
UniProt Gene Name
TUBB8
UniProt Entry Name
TBB8_HUMAN
Uniprot Description
TUBB8: Tubulin is the major constituent of microtubules. It binds two moles of GTP, one at an exchangeable site on the beta chain and one at a non-exchangeable site on the alpha-chain. Belongs to the tubulin family.
Protein type: Cytoskeletal
Chromosomal Location of Human Ortholog: 10p15.3
Cellular Component: microtubule; cytoplasm
Molecular Function: GTPase activity; GTP binding; structural constituent of cytoskeleton
Biological Process: protein polymerization; metabolic process; microtubule-based process
Similar Products
Product Notes
The TUBB8 tubb8 (Catalog #AAA6009582) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TUBB4Q (Beta-tubulin 4Q, Tubulin beta 7 Pseudogene, TUBB7P) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's TUBB4Q can be used in a range of immunoassay formats including, but not limited to, Immunoprecipitation (IP). Suitable for use in Immunoprecipitation. Researchers should empirically determine the suitability of the TUBB8 tubb8 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MRELVLTQTG QCGNQIGAKF WEVISDEHAI DSAGTYHGDS HLQLERINVH HHEASGGRYV SRAVLVDLEP GTMDSVRSGP FGQVFRPDNF ISRQCGAGNN WAKGRYTEGA ELTESVMDVV RKEAESCDCL QGFQLTHSLG GGTGSGMGTL LISKIWEEYP DRIINTLSIL LLPKVSDTVV EPYNATLSVH QLIENADETF CIDNEALYDI CSRTLKLPTP TYGDLNHLVS ATMSGVTTCL CFPDQLNADL RKLAMNMVPF PRLHFFMPGF APLTSRGSQQ YRALTVAELT QQMFDAKNMM AARDPRHGRY LTAAAIFQGR MPMREVDEQM FNIQDKNSSY FADWFPNNVK TAVCDIPPWG LKMSVTFTGN NTAVQELKRV SEQFTATFRR KAFLHWYTGE GMDEMEFTEA ESNMNDLVSE YQQYQDATAE GGGV. It is sometimes possible for the material contained within the vial of "TUBB4Q, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
