Rabbit anti-Human TUBA3D Polyclonal Antibody | anti-TUBA3D antibody

TUBA3D Antibody - N-terminal region

Cat. Num. AAA3221010

• Gene Names: TUBA3C; TUBA2; bA408E5.3
• Reactivity: Human
• Applications: Western Blot
• Purity: Affinity purified
• Synonyms: TUBA3D; Polyclonal Antibody; TUBA3D Antibody - N-terminal region; anti-TUBA3D antibody

• Host: Rabbit
• Reactivity: Human
• Clonality: Polyclonal
• Purity/Purification: Affinity purified
• Form/Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 16% sucrose.
• Sequence: Synthetic peptide located within the following region: DGQMPSDKTIGGGDDSFNTFFSETGAGKHVPRAVFVDLEPTVVDEVRTGT
• Sequence Length: 450

• Applicable Applications for anti-TUBA3D antibody: Western Blot (WB)
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human TUBA3D
• Preparation and Storage: For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: TUBA3CSample Tissue: DLD1 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Related Product Information for anti-TUBA3D antibody

This gene encodes a member of the alpha tubulin family. Tubulin is a major component of microtubules, which are composed of alpha- and beta-tubulin heterodimers and microtubule-associated proteins in the cytoskeleton. Microtubules maintain cellular structure, function in intracellular transport, and play a role in spindle formation during mitosis.

Product Categories/Family for anti-TUBA3D antibody

Polyclonal; Disease Related

NCBI and Uniprot Product Information

• NCBI GI #: 17921993
• NCBI GeneID: 7278
• NCBI Accession #: NP_005992.1
• NCBI GenBank Nucleotide #: NM_006001.2
• UniProt Accession #: Q13748; P0DPH7
• Molecular Weight: 50 kDa
• NCBI Official Full Name: tubulin alpha-3C chain
• NCBI Official Synonym Full Names: tubulin alpha 3c
• NCBI Official Symbol: TUBA3C
• NCBI Official Synonym Symbols: TUBA2; bA408E5.3
• NCBI Protein Information: tubulin alpha-3C chain
• UniProt Protein Name: Tubulin alpha-3C/D chain
• UniProt Gene Name: TUBA3C
• UniProt Synonym Gene Names: TUBA2
• UniProt Entry Name: TBA3C_HUMAN

NCBI Description

Microtubules of the eukaryotic cytoskeleton perform essential and diverse functions and are composed of a heterodimer of alpha and beta tubulin. The genes encoding these microtubule constituents are part of the tubulin superfamily, which is composed of six distinct families. Genes from the alpha, beta and gamma tubulin families are found in all eukaryotes. The alpha and beta tubulins represent the major components of microtubules, while gamma tubulin plays a critical role in the nucleation of microtubule assembly. There are multiple alpha and beta tubulin genes and they are highly conserved among and between species. This gene is an alpha tubulin gene that encodes a protein 99% identical to the mouse testis-specific Tuba3 and Tuba7 gene products. This gene is located in the 13q11 region, which is associated with the genetic diseases Clouston hidrotic ectodermal dysplasia and Kabuki syndrome. [provided by RefSeq, Jul 2008]

Uniprot Description

TUBA3C/D: Tubulin is the major constituent of microtubules. It binds two moles of GTP, one at an exchangeable site on the beta chain and one at a non-exchangeable site on the alpha-chain. Dimer of alpha and beta chains. Testis specific. Belongs to the tubulin family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Cytoskeletal; Motility/polarity/chemotaxis

Chromosomal Location of Human Ortholog: 13q11

Cellular Component: microtubule; cytoplasm; nucleus

Molecular Function: GTPase activity; protein binding; GTP binding; structural constituent of cytoskeleton

Biological Process: protein polymerization; 'de novo' posttranslational protein folding; cellular protein metabolic process; protein folding; microtubule-based process