Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-TUBA3C Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: OVCAR-3 cell lysateTUBA3C is supported by BioGPS gene expression data to be expressed in OVCAR3)

Rabbit TUBA3C Polyclonal Antibody | anti-TUBA3C antibody

TUBA3C antibody - N-terminal region

Gene Names
TUBA3C; TUBA2; bA408E5.3
Reactivity
Cow, Human, Mouse, Pig, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
TUBA3C; Polyclonal Antibody; TUBA3C antibody - N-terminal region; anti-TUBA3C antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Human, Mouse, Pig, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: QMPSDKTIGGGDDSFNTFFSETGAGKHVPRAVFVDLEPTVVDEVRTGTYR
Sequence Length
450
Applicable Applications for anti-TUBA3C antibody
Western Blot (WB)
Homology
Cow: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human TUBA3C
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-TUBA3C Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: OVCAR-3 cell lysateTUBA3C is supported by BioGPS gene expression data to be expressed in OVCAR3)

Western Blot (WB) (WB Suggested Anti-TUBA3C Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: OVCAR-3 cell lysateTUBA3C is supported by BioGPS gene expression data to be expressed in OVCAR3)
Related Product Information for anti-TUBA3C antibody
This is a rabbit polyclonal antibody against TUBA3C. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: Tubulin is the major constituent of microtubules. It binds two moles of GTP, one at an exchangeable site on the beta chain and one at a non-exchangeable site on the alpha-chain.Microtubules of the eukaryotic cytoskeleton perform essential and diverse functions and are composed of a heterodimer of alpha and beta tubulin. The genes encoding these microtubule constituents are part of the tubulin superfamily, which is composed of six distinct families. Genes from the alpha, beta and gamma tubulin families are found in all eukaryotes. The alpha and beta tubulins represent the major components of microtubules, while gamma tubulin plays a critical role in the nucleation of microtubule assembly. There are multiple alpha and beta tubulin genes and they are highly conserved among and between species. This gene is an alpha tubulin gene that encodes a protein 99% identical to the mouse testis-specific Tuba3 and Tuba7 gene products. This gene is located in the 13q11 region, which is associated with the genetic diseases Clouston hidrotic ectodermal dysplasia and Kabuki syndrome. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Product Categories/Family for anti-TUBA3C antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
50kDa
NCBI Official Full Name
tubulin alpha-3C chain
NCBI Official Synonym Full Names
tubulin alpha 3c
NCBI Official Symbol
TUBA3C
NCBI Official Synonym Symbols
TUBA2; bA408E5.3
NCBI Protein Information
tubulin alpha-3C chain
UniProt Protein Name
Tubulin alpha-3C/D chain
Protein Family
UniProt Gene Name
TUBA3C
UniProt Synonym Gene Names
TUBA2
UniProt Entry Name
TBA3C_HUMAN

NCBI Description

Microtubules of the eukaryotic cytoskeleton perform essential and diverse functions and are composed of a heterodimer of alpha and beta tubulin. The genes encoding these microtubule constituents are part of the tubulin superfamily, which is composed of six distinct families. Genes from the alpha, beta and gamma tubulin families are found in all eukaryotes. The alpha and beta tubulins represent the major components of microtubules, while gamma tubulin plays a critical role in the nucleation of microtubule assembly. There are multiple alpha and beta tubulin genes and they are highly conserved among and between species. This gene is an alpha tubulin gene that encodes a protein 99% identical to the mouse testis-specific Tuba3 and Tuba7 gene products. This gene is located in the 13q11 region, which is associated with the genetic diseases Clouston hidrotic ectodermal dysplasia and Kabuki syndrome. [provided by RefSeq, Jul 2008]

Uniprot Description

TUBA3C/D: Tubulin is the major constituent of microtubules. It binds two moles of GTP, one at an exchangeable site on the beta chain and one at a non-exchangeable site on the alpha-chain. Dimer of alpha and beta chains. Testis specific. Belongs to the tubulin family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Cytoskeletal; Motility/polarity/chemotaxis

Chromosomal Location of Human Ortholog: 13q11

Cellular Component: microtubule; cytoplasm; nucleus

Molecular Function: GTPase activity; protein binding; GTP binding; structural constituent of cytoskeleton

Biological Process: protein polymerization; 'de novo' posttranslational protein folding; cellular protein metabolic process; protein folding; microtubule-based process

Research Articles on TUBA3C

Similar Products

Product Notes

The TUBA3C tuba3c (Catalog #AAA3211425) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TUBA3C antibody - N-terminal region reacts with Cow, Human, Mouse, Pig, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's TUBA3C can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the TUBA3C tuba3c for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: QMPSDKTIGG GDDSFNTFFS ETGAGKHVPR AVFVDLEPTV VDEVRTGTYR. It is sometimes possible for the material contained within the vial of "TUBA3C, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.