Western Blot (WB)
(WB Suggested Anti-TRPC4AP Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human heart)
Rabbit TRPC4AP Polyclonal Antibody | anti-TRPC4AP antibody
TRPC4AP antibody - middle region
Gene Names
TRPC4AP; TRUSS; TRRP4AP; PPP1R158; C20orf188
Reactivity
Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
TRPC4AP; Polyclonal Antibody; TRPC4AP antibody - middle region; anti-TRPC4AP antibody
Host
Rabbit
Reactivity
Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: GASEENGLPHTSARTQLPQSMKIMHEIMYKLEVLYVLCVLLMGRQRNQVH
Sequence Length
797
Applicable Applications for anti-TRPC4AP antibody
Western Blot (WB)
Homology
Dog: 93%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 86%; Rabbit: 86%; Rat: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human TRPC4AP
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-TRPC4AP Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human heart)
Western Blot (WB)
(WB Suggested Anti-TRPC4AP Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human heart)
Related Product Information for anti-TRPC4AP antibody
This is a rabbit polyclonal antibody against TRPC4AP. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: TRPC4AP may participate in the activation of NFKB1 in response to ligation of TNFRSF1A. TRPC4AP could serve as a scaffolding protein to link TNFRSF1A to the IKK signalosome.
Target Description: TRPC4AP may participate in the activation of NFKB1 in response to ligation of TNFRSF1A. TRPC4AP could serve as a scaffolding protein to link TNFRSF1A to the IKK signalosome.
Product Categories/Family for anti-TRPC4AP antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
91kDa
NCBI Official Full Name
short transient receptor potential channel 4-associated protein isoform a
NCBI Official Synonym Full Names
transient receptor potential cation channel subfamily C member 4 associated protein
NCBI Official Symbol
TRPC4AP
NCBI Official Synonym Symbols
TRUSS; TRRP4AP; PPP1R158; C20orf188
NCBI Protein Information
short transient receptor potential channel 4-associated protein
UniProt Protein Name
Short transient receptor potential channel 4-associated protein
UniProt Gene Name
TRPC4AP
UniProt Synonym Gene Names
C20orf188; TRRP4AP; Trp4-associated protein; Trpc4-associated protein; Protein TRUSS
UniProt Entry Name
TP4AP_HUMAN
Research Articles on TRPC4AP
Similar Products
Product Notes
The TRPC4AP trpc4ap (Catalog #AAA3212152) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TRPC4AP antibody - middle region reacts with Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's TRPC4AP can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the TRPC4AP trpc4ap for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: GASEENGLPH TSARTQLPQS MKIMHEIMYK LEVLYVLCVL LMGRQRNQVH. It is sometimes possible for the material contained within the vial of "TRPC4AP, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
