Immunohistochemistry (IHC)
(Tropomyosin 2 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml. Magnification is at 400X)
Rabbit anti-Human, Mouse Tropomyosin 2 Polyclonal Antibody | anti-TPM2 antibody
Tropomyosin 2 Antibody
Gene Names
Tm2; CG4843; DmelCG4843; dro Tm; DROTROPI1; Ifm(3)3; Ifm(3)5; Ifm-TmI; IP16005p; l(3)nc99Eb; mTmI; Tm; Tm1; Tm127; TM2; TmI; TmII; Tn-H
Reactivity
Human, Mouse
Applications
Western Blot, Immunohistochemistry
Purity
Total IgG Protein A purified
Synonyms
Tropomyosin 2; Polyclonal Antibody; Tropomyosin 2 Antibody; Rabbit Polyclonal Tropomyosin 2 Antibody; Polyclonal Tropomyosin 2 antibody; Anti-Tropomyosin 2 antibody; Tropomyosin -2 antibody; Tropomyosin -2; TPM2 antibody; AMCD1 antibody; Tropomyosin 2 antibody; TMSB antibody; DA1 antibody; anti-TPM2 antibody
Host
Rabbit
Reactivity
Human, Mouse
Clonality
Polyclonal
Purity/Purification
Total IgG Protein A purified
Form/Format
Liquid; in 1x PBS buffer with 0.09% (w/v) Sodium Azide and 2% Sucrose.
Concentration
1 mg/ml (varies by lot)
Sequence Length
284
Applicable Applications for anti-TPM2 antibody
Western Blot (WB), Immunohistochemistry (IHC)
Application Notes
This is a rabbit polyclonal antibody against TPM2. It was validated on Western Blot and immunohistochemistry. We usually provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein.
WB: 2.5 ug/ml
IHC: 4-8 ug/ml
WB: 2.5 ug/ml
IHC: 4-8 ug/ml
Immunogen
Tropomyosin 2 antibody was raised using a synthetic peptide corresponding to a region with amino acids AETRAEFAERSVAKLEKTIDDLEDEVYAQKMKYKAISEELDNALNDITSL
Cross-Reactivity
Human,Mouse
Preparation and Storage
Store at 2-8 degree C for short periods. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Immunohistochemistry (IHC)
(Tropomyosin 2 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml. Magnification is at 400X)
Immunohistochemistry (IHC)
(Tropomyosin 2 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml. Magnification is at 400X)
Western Blot (WB)
(Tropomyosin 2 antibody used at 2.5 ug/ml to detect target protein.)
Western Blot (WB)
(Tropomyosin 2 antibody used at 2.5 ug/ml to detect target protein.)
Immunohistochemistry (IHC)
(Tropomyosin 2 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Skeletal muscle cells (arrows) in Human Muscle. Magnification is at 400X)
Immunohistochemistry (IHC)
(Tropomyosin 2 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Skeletal muscle cells (arrows) in Human Muscle. Magnification is at 400X)
Related Product Information for anti-TPM2 antibody
The TPM2 gene encodes beta-tropomyosin, an isoform of tropomyosin that is mainly expressed in slow, type 1 muscle fibers.
Product Categories/Family for anti-TPM2 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
33 kDa (MW of target protein)
NCBI Official Full Name
tropomyosin 2, isoform G
NCBI Official Synonym Full Names
Tropomyosin 2
NCBI Official Symbol
Tm2
NCBI Official Synonym Symbols
CG4843; DmelCG4843; dro Tm; DROTROPI1; Ifm(3)3; Ifm(3)5; Ifm-TmI; IP16005p; l(3)nc99Eb; mTmI; Tm; Tm1; Tm127; TM2; TmI; TmII; Tn-H
NCBI Protein Information
tropomyosin 2
UniProt Protein Name
Tropomyosin-2
Protein Family
UniProt Gene Name
Tm2
UniProt Synonym Gene Names
TmI
Uniprot Description
Tropomyosin, in association with the troponin complex, plays a central role in the calcium dependent regulation of muscle contraction. May also regulate motor systems required to maintain nuclear integrity and apico-basal polarity during embryogenesis.
Research Articles on TPM2
Similar Products
Product Notes
The TPM2 tm2 (Catalog #AAA5311843) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Tropomyosin 2 Antibody reacts with Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's Tropomyosin 2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB), Immunohistochemistry (IHC). This is a rabbit polyclonal antibody against TPM2. It was validated on Western Blot and immunohistochemistry. We usually provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. WB: 2.5 ug/ml IHC: 4-8 ug/ml. Researchers should empirically determine the suitability of the TPM2 tm2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Tropomyosin 2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
