Immunohistochemistry (IHC)
(Cytokeratin 18 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Alveolar cells (arrows) in Human Lung. Magnification is at 400X)
Rabbit Cytokeratin 18 Polyclonal Antibody | anti-CK-18 antibody
Cytokeratin 18 Antibody
Gene Names
KRT18; K18; CK-18; CYK18
Applications
Western Blot, Immunohistochemistry
Purity
Total IgG Protein A purified
Synonyms
Cytokeratin 18; Polyclonal Antibody; Cytokeratin 18 Antibody; Rabbit Polyclonal Cytokeratin 18 Antibody raised against the C terminal of KRT18; Polyclonal Cytokeratin 18 antibody; Anti-Cytokeratin 18 antibody; Cytokeratin -18; Cytokeratin 18 antibody; CK18 antibody; Cytokeratin -18 antibody; KRT18 antibody; Keratin 18 antibody; K18 antibody; anti-CK-18 antibody
Host
Rabbit
Clonality
Polyclonal
Specificity
Cytokeratin 18 antibody was raised against the C terminal of KRT18
Purity/Purification
Total IgG Protein A purified
Form/Format
Liquid; in 1x PBS buffer with 0.09% (w/v) Sodium Azide and 2% Sucrose.
Concentration
1 mg/ml (varies by lot)
Sequence Length
430
Applicable Applications for anti-CK-18 antibody
Western Blot (WB), Immunohistochemistry (IHC)
Application Notes
This is a rabbit polyclonal antibody against KRT18. It was validated on Western Blot and immunohistochemistry. We usually provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein.
WB: 1.25 ug/ml
IHC: 4-8 ug/ml
WB: 1.25 ug/ml
IHC: 4-8 ug/ml
Immunogen
Cytokeratin 18 antibody was raised using the C terminal of KRT18 corresponding to a region with amino acids ALLNIKVKLEAEIATYRRLLEDGEDFNLGDALDSSNSMQTIQKTTTRRIV
Cross-Reactivity
Human
Preparation and Storage
Store at 2-8 degree C for short periods. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Immunohistochemistry (IHC)
(Cytokeratin 18 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Alveolar cells (arrows) in Human Lung. Magnification is at 400X)
Immunohistochemistry (IHC)
(Cytokeratin 18 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Alveolar cells (arrows) in Human Lung. Magnification is at 400X)
Western Blot (WB)
(Cytokeratin 18 antibody used at 1.25 ug/ml to detect target protein.)
Western Blot (WB)
(Cytokeratin 18 antibody used at 1.25 ug/ml to detect target protein.)
Related Product Information for anti-CK-18 antibody
KRT18 (Keratin 18) is type I intermediate filament chain. Keratin 18, together with its filament partner keratin 8, are perhaps the most commonly found members of the intermediate filament gene family. They are expressed in single layer epithelial tissues of the body. Mutations in this gene have been linked to cryptogenic cirrhosis.
Product Categories/Family for anti-CK-18 antibody
NCBI and Uniprot Product Information
NCBI Description
KRT18 encodes the type I intermediate filament chain keratin 18. Keratin 18, together with its filament partner keratin 8, are perhaps the most commonly found members of the intermediate filament gene family. They are expressed in single layer epithelial tissues of the body. Mutations in this gene have been linked to cryptogenic cirrhosis. Two transcript variants encoding the same protein have been found for this gene. [provided by RefSeq, Jul 2008]
Research Articles on CK-18
Similar Products
Product Notes
The CK-18 (Catalog #AAA5312822) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's Cytokeratin 18 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB), Immunohistochemistry (IHC). This is a rabbit polyclonal antibody against KRT18. It was validated on Western Blot and immunohistochemistry. We usually provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. WB: 1.25 ug/ml IHC: 4-8 ug/ml. Researchers should empirically determine the suitability of the CK-18 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Cytokeratin 18, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
