Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunohistochemistry (IHC) (Human Muscle )

Rabbit TRIM32 Polyclonal Antibody | anti-TRIM32 antibody

TRIM32 antibody - C-terminal region

Gene Names
TRIM32; HT2A; BBS11; TATIP; LGMD2H; LGMDR8
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Immunohistochemistry, Western Blot
Purity
Protein A purified
Synonyms
TRIM32; Polyclonal Antibody; TRIM32 antibody - C-terminal region; anti-TRIM32 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: GQLGRQISHFFSENEDFRCIAGMCVDARGDLIVADSSRKEILHFPKGGGY
Sequence Length
653
Applicable Applications for anti-TRIM32 antibody
Immunohistochemistry (IHC), Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 83%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human TRIM32
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Immunohistochemistry (IHC)

(Human Muscle )

Immunohistochemistry (IHC) (Human Muscle )

Western Blot (WB)

(Host: RabbitTarget Name: TRIM32Sample Tissue: Human A549 Whole CellAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: TRIM32Sample Tissue: Human A549 Whole CellAntibody Dilution: 1ug/ml)

Western Blot (WB)

(WB Suggested Anti-TRIM32 Antibody Titration: 1.025 ug/mlPositive Control: 293T cells lysateTRIM32 is supported by BioGPS gene expression data to be expressed in HEK293T)

Western Blot (WB) (WB Suggested Anti-TRIM32 Antibody Titration: 1.025 ug/mlPositive Control: 293T cells lysateTRIM32 is supported by BioGPS gene expression data to be expressed in HEK293T)
Related Product Information for anti-TRIM32 antibody
This is a rabbit polyclonal antibody against TRIM32. It was validated on Western Blot and immunohistochemistry

Target Description: TRIM32 is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. TRIM32 localizes to cytoplasmic bodies. The protein has also been localized to the nucleus, where it interacts with the activation domain of the HIV-1 Tat protein. The Tat protein activates transcription of HIV-1 genes.The protein encoded by this gene is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. The protein localizes to cytoplasmic bodies. The protein has also been localized to the nucleus, where it interacts with the activation domain of the HIV-1 Tat protein. The Tat protein activates transcription of HIV-1 genes.The protein encoded by this gene is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. The protein localizes to cytoplasmic bodies. The protein has also been localized to the nucleus, where it interacts with the activation domain of the HIV-1 Tat protein. The Tat protein activates transcription of HIV-1 genes.The protein encoded by this gene is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. The protein localizes to cytoplasmic bodies. The protein has also been localized to the nucleus, where it interacts with the activation domain of the HIV-1 Tat protein. The Tat protein activates transcription of HIV-1 genes.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
72kDa
NCBI Official Full Name
E3 ubiquitin-protein ligase TRIM32
NCBI Official Synonym Full Names
tripartite motif containing 32
NCBI Official Symbol
TRIM32
NCBI Official Synonym Symbols
HT2A; BBS11; TATIP; LGMD2H; LGMDR8
NCBI Protein Information
E3 ubiquitin-protein ligase TRIM32
UniProt Protein Name
E3 ubiquitin-protein ligase TRIM32
UniProt Gene Name
TRIM32
UniProt Synonym Gene Names
HT2A
UniProt Entry Name
TRI32_HUMAN

NCBI Description

The protein encoded by this gene is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. The protein localizes to cytoplasmic bodies. The protein has also been localized to the nucleus, where it interacts with the activation domain of the HIV-1 Tat protein. The Tat protein activates transcription of HIV-1 genes. [provided by RefSeq, Jul 2008]

Uniprot Description

TRIM32: Has an E3 ubiquitin ligase activity. Ubiquitinates DTNBP1 (dysbindin) and promotes its degradation. May play a significant role in mediating the biological activity of the HIV-1 Tat protein in vivo. Binds specifically to the activation domain of HIV-1 Tat and can also interact with the HIV-2 and EIAV Tat proteins in vivo. Defects in TRIM32 are the cause of limb-girdle muscular dystrophy type 2H (LGMD2H); also known as muscular dystrophy Hutterite type. LGMD2H is an autosomal recessive degenerative myopathy characterized by pelvic girdle, shoulder girdle and quadriceps muscle weakness. Clinical phenotype and severity are highly variable. Disease progression is slow and most patients remain ambulatory into the sixth decade of life. Defects in TRIM32 are the cause of Bardet-Biedl syndrome type 11 (BBS11). Bardet-Biedl syndrome (BBS) is a genetically heterogeneous, autosomal recessive disorder characterized by usually severe pigmentary retinopathy, early onset obesity, polydactyly, hypogenitalism, renal malformation and mental retardation. Secondary features include diabetes mellitus, hypertension and congenital heart disease. A relatively high incidence of BBS is found in the mixed Arab populations of Kuwait and in Bedouin tribes throughout the Middle East, most likely due to the high rate of consaguinity in these populations and a founder effect. Belongs to the TRIM/RBCC family.

Protein type: Ubiquitin ligase; EC 6.3.2.19; EC 6.3.2.-; Ubiquitin conjugating system; Ligase

Chromosomal Location of Human Ortholog: 9q33.1

Cellular Component: cytoplasm; striated muscle thick filament; cytosol; nucleus

Molecular Function: protein binding; ubiquitin binding; protein self-association; myosin binding; zinc ion binding; translation initiation factor binding; RNA binding; Tat protein binding; transcription coactivator activity; ubiquitin-protein ligase activity; ligase activity

Biological Process: fat cell differentiation; regulation of interferon type I production; positive regulation of neurogenesis; positive regulation of I-kappaB kinase/NF-kappaB cascade; protein polyubiquitination; positive regulation of proteolysis; protein ubiquitination during ubiquitin-dependent protein catabolic process; protein ubiquitination; positive regulation of cell cycle; positive regulation of cell growth; activation of NF-kappaB transcription factor; negative regulation of viral transcription; negative regulation of fibroblast proliferation; positive regulation of interferon type I production; positive regulation of protein catabolic process; innate immune response; positive regulation of transcription factor activity; positive regulation of neuron differentiation; response to UV; positive regulation of cell migration

Disease: Muscular Dystrophy, Limb-girdle, Type 2h; Bardet-biedl Syndrome 11

Research Articles on TRIM32

Similar Products

Product Notes

The TRIM32 trim32 (Catalog #AAA3204371) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TRIM32 antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's TRIM32 can be used in a range of immunoassay formats including, but not limited to, Immunohistochemistry (IHC), Western Blot (WB). Researchers should empirically determine the suitability of the TRIM32 trim32 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: GQLGRQISHF FSENEDFRCI AGMCVDARGD LIVADSSRKE ILHFPKGGGY. It is sometimes possible for the material contained within the vial of "TRIM32, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.