Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: SERPINA3Sample Type: Human Adult PlacentaAntibody Dilution: 1.0ug/ml)

Rabbit anti-Human PML Polyclonal Antibody | anti-PML antibody

PML antibody - middle region

Gene Names
PML; MYL; RNF71; PP8675; TRIM19
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
PML; Polyclonal Antibody; PML antibody - middle region; anti-PML antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Specificity
isoform 1, 9, 10 and 11 specific
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: TTLPPAQPAFNLQALGTYFEGLLEGPALARAEGVSTPLAGRGLAERASQQ
Sequence Length
882
Applicable Applications for anti-PML antibody
Western Blot (WB)
Homology
Human: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human PML
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: SERPINA3Sample Type: Human Adult PlacentaAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: SERPINA3Sample Type: Human Adult PlacentaAntibody Dilution: 1.0ug/ml)

Western Blot (WB)

(PML antibody - middle region validated by WB using Neuroblastoma at 1:500.)

Western Blot (WB) (PML antibody - middle region validated by WB using Neuroblastoma at 1:500.)

Western Blot (WB)

(WB Suggested Anti-PML Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:12500Positive Control: ACHN cell lysateThere is BioGPS gene expression data showing that PML is expressed in ACHN)

Western Blot (WB) (WB Suggested Anti-PML Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:12500Positive Control: ACHN cell lysateThere is BioGPS gene expression data showing that PML is expressed in ACHN)
Related Product Information for anti-PML antibody
This is a rabbit polyclonal antibody against PML. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: PML is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. PML localizes to nuclear bodies where it functions as a transcription factor an

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
97kDa
NCBI Official Full Name
protein PML isoform 1
NCBI Official Synonym Full Names
promyelocytic leukemia
NCBI Official Symbol
PML
NCBI Official Synonym Symbols
MYL; RNF71; PP8675; TRIM19
NCBI Protein Information
protein PML
UniProt Protein Name
Protein PML
Protein Family
UniProt Gene Name
PML
UniProt Synonym Gene Names
MYL; PP8675; RNF71; TRIM19
UniProt Entry Name
PML_HUMAN

NCBI Description

The protein encoded by this gene is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. This phosphoprotein localizes to nuclear bodies where it functions as a transcription factor and tumor suppressor. Its expression is cell-cycle related and it regulates the p53 response to oncogenic signals. The gene is often involved in the translocation with the retinoic acid receptor alpha gene associated with acute promyelocytic leukemia (APL). Extensive alternative splicing of this gene results in several variations of the protein's central and C-terminal regions; all variants encode the same N-terminus. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq, Jul 2008]

Uniprot Description

PML: a zinc-finger protein that can regulate transcription and can localize to nuclear bodies. Cytoplasmic forms regulate glycolysis by inhibiting the tetrameric form of PKM2. Together with SATB1, involved in local chromatin-loop remodeling and gene expression regulation at the MHC-I locus. Interacts with SIRT1, TOPBP1, TRIM27 and TRIM69. Sumoylated forms interact with SATB1 and localize to the PML nuclear bodies. Sumoylation on three sites is required for nuclear body formation. Sumoylation on Lys-160 is a prerequisite for sumoylation on Lys-65. The B1 box and the RING finger are also required for localization to nuclear bodies. May play an important role in recruitment of ELF4 into PML nuclear bodies. A chromosomal aberration involving PML can cause acute promyelocytic leukemia (APL). Seven alternatively-spliced human isoforms have been reported.

Protein type: Ubiquitin conjugating system; Tumor suppressor; Transcription factor; Nucleolus; Oncoprotein

Chromosomal Location of Human Ortholog: 15q22

Cellular Component: nucleoplasm; PML body; nuclear membrane; nuclear matrix; early endosome membrane; cytoplasm; nucleolus; nucleus; cytosol

Molecular Function: protein binding; protein homodimerization activity; SUMO binding; DNA binding; zinc ion binding; protein heterodimerization activity; ubiquitin protein ligase binding; transcription coactivator activity; SMAD binding; cobalt ion binding

Biological Process: retinoic acid receptor signaling pathway; proteasomal ubiquitin-dependent protein catabolic process; viral reproduction; apoptosis; positive regulation of apoptosis involved in mammary gland involution; regulation of MHC class I biosynthetic process; PML body organization and biogenesis; SMAD protein nuclear translocation; DNA damage response, signal transduction by p53 class mediator resulting in cell cycle arrest; entrainment of circadian clock by photoperiod; negative regulation of cell proliferation; positive regulation of histone deacetylation; regulation of transcription, DNA-dependent; transforming growth factor beta receptor signaling pathway; response to gamma radiation; protein complex assembly; negative regulation of mitotic cell cycle; circadian regulation of gene expression; maintenance of protein localization in nucleus; cell cycle arrest; defense response to virus; negative regulation of telomere maintenance via telomerase; DNA damage response, signal transduction by p53 class mediator resulting in induction of apoptosis; response to UV; caspase activation; regulation of protein amino acid phosphorylation; cell fate commitment; protein stabilization; transcription, DNA-dependent; cytokine and chemokine mediated signaling pathway; common-partner SMAD protein phosphorylation; regulation of circadian rhythm; negative regulation of telomerase activity; endoplasmic reticulum calcium ion homeostasis; negative regulation of angiogenesis; DNA damage response, signal transduction resulting in induction of apoptosis; response to cytokine stimulus; response to hypoxia; innate immune response; myeloid cell differentiation; negative regulation of translation in response to oxidative stress; negative regulation of cell growth; positive regulation of defense response to virus by host; negative regulation of transcription, DNA-dependent; induction of apoptosis by oxidative stress; protein targeting

Research Articles on PML

Similar Products

Product Notes

The PML pml (Catalog #AAA3204824) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PML antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's PML can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the PML pml for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: TTLPPAQPAF NLQALGTYFE GLLEGPALAR AEGVSTPLAG RGLAERASQQ. It is sometimes possible for the material contained within the vial of "PML, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.