Rabbit anti-Human TRIB2 Polyclonal Antibody | anti-TRIB2 antibody

TRIB2 (Tribbles Homolog 2, TRB2, TRB-2, C5FW, GS3955) (HRP)

Cat. Num. AAA6397153

• Gene Names: TRIB2; C5FW; TRB2; GS3955
• Reactivity: Human
• Applications: Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: TRIB2; Polyclonal Antibody; TRIB2 (Tribbles Homolog 2; TRB2; TRB-2; C5FW; GS3955) (HRP); anti-TRIB2 antibody

• Host: Rabbit
• Reactivity: Human
• Clonality: Polyclonal
• Isotype: IgG
• Specificity: Recognizes human TRIB2.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Horseradish Peroxidase (HRP).
• Sequence Length: 4221

• Applicable Applications for anti-TRIB2 antibody: Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Full length human TRIB2, aa1-343 (NP_067675.1).
• Immunogen Sequence: MNIHRSTPITIARYGRSRNKTQDFEELSSIRSAEPSQSFSPNLGSPSPPETPNLSHCVSCIGKYLLLEPLEGDHVFRAVHLHSGEELVCKVFDISCYQESLAPCFCLSAHSNINQITEIILGETKAYVFFERSYGDMHSFVRTCKKLREEEAARLFYQIASAVAHCHDGGLVLRDLKLRKFIFKDEERTRVKLESLEDAYILRGDDDSLSDKHGCPAYVSPEILNTSGSYSGKAADVWSLGVMLYTMLVGRYPFHDIEPSSLFSKIRRGQFNIPETLSPKAKCLIRSILRREPSERLTSQEILDHPWFSTDFSVSNSAYGAKEVSDQLVPDVNMEENLDPFFN
• Conjugate: HRP
• Note: Preservative Free
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of TRIB2 expression in transfected 293T cell line by TRIB2 polyclonal antibody. Lane 1: TRIB2 transfected lysate (38.8kD). Lane 2: Non-transfected lysate.)

Product Categories/Family for anti-TRIB2 antibody

Antibodies; Protein Kinases

NCBI and Uniprot Product Information

• NCBI GI #: 11056053
• NCBI GeneID: 28951
• NCBI Accession #: NM_021643.1
• NCBI GenBank Nucleotide #: NM_021643.1
• NCBI Official Full Name: Homo sapiens tribbles homolog 2 (Drosophila) (TRIB2), mRNA
• NCBI Official Synonym Full Names: tribbles pseudokinase 2
• NCBI Official Symbol: TRIB2
• NCBI Official Synonym Symbols: C5FW; TRB2; GS3955
• NCBI Protein Information: tribbles homolog 2
• Protein Family: Tribbles

NCBI Description

This gene encodes one of three members of the Tribbles family. The Tribbles members share a Trb domain, which is homologous to protein serine-threonine kinases, but lacks the active site lysine and probably lacks a catalytic function. The Tribbles proteins interact and modulate the activity of signal transduction pathways in a number of physiological and pathological processes. This Tribbles member induces apoptosis of cells mainly of the hematopoietic origin. It has been identified as a protein up-regulated by inflammatory stimuli in myeloid (THP-1) cells, and also as an oncogene that inactivates the transcription factor C/EBPalpha (CCAAT/enhancer-binding protein alpha) and causes acute myelogenous leukemia. Alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Mar 2009]