Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (37.11kD).)

Mouse anti-Human TFB2M Monoclonal Antibody | anti-tfb2m antibody

TFB2M (Dimethyladenosine Transferase 2, Mitochondrial, Hepatitis C Virus NS5A-transactivated Protein 5, HCV NS5A-transactivated Protein 5, NS5ATP5, Mitochondrial 12S rRNA Dimethylase 2, Mitochondrial Transcription Factor B2, h-mtTFB, h-mtTFB2, hTFB2M, mtT

Gene Names
tfb2m; sb:cb857
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
TFB2M; Monoclonal Antibody; TFB2M (Dimethyladenosine Transferase 2; Mitochondrial; Hepatitis C Virus NS5A-transactivated Protein 5; HCV NS5A-transactivated Protein 5; NS5ATP5; Mitochondrial 12S rRNA Dimethylase 2; Mitochondrial Transcription Factor B2; h-mtTFB; h-mtTFB2; hTFB2M; mtT; Anti -TFB2M (Dimethyladenosine Transferase 2; anti-tfb2m antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
2E10
Specificity
Recognizes human TFB2M.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
YLIQMIPRQNLFTKNLTPMNYNIFFHLLKHCFGRRSATVIDHLRSLTPLDARDILMQIGKQEDEKVVNMHPQDFKTLFETIERSKDCAYKWLYDETLEDR
Applicable Applications for anti-tfb2m antibody
ELISA (EL/EIA), Western Blot (WB)
Application Notes
Suitable for use in ELISA and Western Blot.
Immunogen
Partial recombinant corresponding to aa297-397 from human TFB2M (NP_071761) with GST tag. MW of the GST tag alone is 26kD.
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.11kD).)

Western Blot (WB) (Western Blot detection against Immunogen (37.11kD).)

Western Blot (WB)

(TFB2M monoclonal antibody. Western Blot analysis of TFB2M expression in human kidney.)

Western Blot (WB) (TFB2M monoclonal antibody. Western Blot analysis of TFB2M expression in human kidney.)

Western Blot (WB)

(TFB2M monoclonal antibody. Western Blot analysis of TFB2M expression in HeLa.)

Western Blot (WB) (TFB2M monoclonal antibody. Western Blot analysis of TFB2M expression in HeLa.)

Testing Data

(Detection limit for recombinant GST tagged TFB2M is 0.03ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged TFB2M is 0.03ng/ml as a capture antibody.)
Product Categories/Family for anti-tfb2m antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Official Full Name
Tfb2m protein
NCBI Official Synonym Full Names
transcription factor B2, mitochondrial
NCBI Official Symbol
tfb2m
NCBI Official Synonym Symbols
sb:cb857
NCBI Protein Information
dimethyladenosine transferase 2, mitochondrial

Similar Products

Product Notes

The tfb2m (Catalog #AAA6003699) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The TFB2M (Dimethyladenosine Transferase 2, Mitochondrial, Hepatitis C Virus NS5A-transactivated Protein 5, HCV NS5A-transactivated Protein 5, NS5ATP5, Mitochondrial 12S rRNA Dimethylase 2, Mitochondrial Transcription Factor B2, h-mtTFB, h-mtTFB2, hTFB2M, mtT reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's TFB2M can be used in a range of immunoassay formats including, but not limited to, ELISA (EL/EIA), Western Blot (WB). Suitable for use in ELISA and Western Blot. Researchers should empirically determine the suitability of the tfb2m for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: YLIQMIPRQN LFTKNLTPMN YNIFFHLLKH CFGRRSATVI DHLRSLTPLD ARDILMQIGK QEDEKVVNMH PQDFKTLFET IERSKDCAYK WLYDETLEDR. It is sometimes possible for the material contained within the vial of "TFB2M, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.