Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: TREML1Antibody Dilution: 1.0ug/mlSample Type: Human Placenta)

Rabbit anti-Human TREML1 Polyclonal Antibody | anti-TREML1 antibody

TREML1 antibody - C-terminal region

Gene Names
TREML1; TLT1; TLT-1; PRO3438; GLTL1825; dJ238O23.3
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
TREML1; Polyclonal Antibody; TREML1 antibody - C-terminal region; anti-TREML1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: PSSLPPLPPKVLVCSKPVTYATVIFPGGNKGGGTSCGPAQNPPNNQTPSS
Sequence Length
311
Applicable Applications for anti-TREML1 antibody
Western Blot (WB)
Homology
Human: 100%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: TREML1Antibody Dilution: 1.0ug/mlSample Type: Human Placenta)

Western Blot (WB) (Host: RabbitTarget Name: TREML1Antibody Dilution: 1.0ug/mlSample Type: Human Placenta)
Related Product Information for anti-TREML1 antibody
This is a rabbit polyclonal antibody against TREML1. It was validated on Western Blot

Target Description: TREML1 is located in a gene cluster on chromosome 6 with the single Ig variable (IgV) domain activating receptors TREM1 and TREM2, but it has distinct structural and functional properties. TREML1 enhances calcium signaling in an SHP2-dependent manner.
Product Categories/Family for anti-TREML1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
31kDa
NCBI Official Full Name
trem-like transcript 1 protein isoform b
NCBI Official Synonym Full Names
triggering receptor expressed on myeloid cells like 1
NCBI Official Symbol
TREML1
NCBI Official Synonym Symbols
TLT1; TLT-1; PRO3438; GLTL1825; dJ238O23.3
NCBI Protein Information
trem-like transcript 1 protein
UniProt Protein Name
Trem-like transcript 1 protein
UniProt Gene Name
TREML1
UniProt Synonym Gene Names
TLT1; TLT-1
UniProt Entry Name
TRML1_HUMAN

NCBI Description

This gene encodes a member of the triggering receptor expressed on myeloid cells-like (TREM) family. The encoded protein is a type 1 single Ig domain orphan receptor localized to the alpha-granule membranes of platelets. The encoded protein is involved in platelet aggregation, inflammation, and cellular activation and has been linked to Gray platelet syndrome. Alternative splicing results in multiple transcript variants [provided by RefSeq, Nov 2012]

Uniprot Description

TREML1: Cell surface receptor that may play a role in the innate and adaptive immune response. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Immunoglobulin superfamily; Membrane protein, integral

Chromosomal Location of Human Ortholog: 6p21.1

Cellular Component: plasma membrane

Biological Process: regulation of immune response

Research Articles on TREML1

Similar Products

Product Notes

The TREML1 treml1 (Catalog #AAA3216767) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TREML1 antibody - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's TREML1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the TREML1 treml1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: PSSLPPLPPK VLVCSKPVTY ATVIFPGGNK GGGTSCGPAQ NPPNNQTPSS. It is sometimes possible for the material contained within the vial of "TREML1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.