Immunohistochemistry (IHC)
(JAG2 antibody - N-terminal region Formalin Fixed Paraffin Embedded Tissue: Human Bronchial Epithelial Tissue Observed Staining: Membrane of bronchial epithelial tissuePrimary Antibody Concentration: 1:100 Secondary Antibody: Donkey anti-Rabbit-Cy3 Secondary Antibody Concentration: 1:200 Magnification: 20X Exposure Time: 0.5 - 2.0 sec)
Rabbit JAG2 Polyclonal Antibody | anti-JAG2 antibody
JAG2 antibody - N-terminal region
Gene Names
JAG2; HJ2; SER2
Reactivity
Tested Reactivity: HumanPredicted Reactivity: Human, Mouse, Pig, Rat
Applications
Western Blot, Immunohistochemistry
Purity
Affinity Purified
Synonyms
JAG2; Polyclonal Antibody; JAG2 antibody - N-terminal region; anti-JAG2 antibody
Host
Rabbit
Reactivity
Tested Reactivity: Human
Predicted Reactivity: Human, Mouse, Pig, Rat
Predicted Reactivity: Human, Mouse, Pig, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml (varies by lot)
Sequence
RAQGRGRLPRRLLLLLALWVQAARPMGYFELQLSALRNVNGELLSGACCD
Applicable Applications for anti-JAG2 antibody
Western Blot (WB), Immunohistochemistry (IHC)
Protein Size (# AA)
1238 amino acids
Protein Interactions
GFI1B; ATN1; ATXN7; CACNA1A; MIB2; NOTCH3; NOTCH2; NOTCH1;
Blocking Peptide
For anti-JAG2 (MBS3207698) antibody is Catalog # MBS3232664
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human JAG2
Replacement Item
This antibody may replace item sc-8157 from Santa Cruz Biotechnology.
Predicted Homology
Human: 100%; Mouse: 100%; Pig: 100%; Rat: 100%
Preparation and Storage
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Immunohistochemistry (IHC)
(JAG2 antibody - N-terminal region Formalin Fixed Paraffin Embedded Tissue: Human Bronchial Epithelial Tissue Observed Staining: Membrane of bronchial epithelial tissuePrimary Antibody Concentration: 1:100 Secondary Antibody: Donkey anti-Rabbit-Cy3 Secondary Antibody Concentration: 1:200 Magnification: 20X Exposure Time: 0.5 - 2.0 sec)
Immunohistochemistry (IHC)
(JAG2 antibody - N-terminal region Formalin Fixed Paraffin Embedded Tissue: Human Bronchial Epithelial Tissue Observed Staining: Membrane of bronchial epithelial tissuePrimary Antibody Concentration: 1:100 Secondary Antibody: Donkey anti-Rabbit-Cy3 Secondary Antibody Concentration: 1:200 Magnification: 20X Exposure Time: 0.5 - 2.0 sec)
Western Blot (WB)
(WB Suggested Anti-JAG2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Jurkat cell lysate)
Western Blot (WB)
(WB Suggested Anti-JAG2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Jurkat cell lysate)
Related Product Information for anti-JAG2 antibody
The Notch signaling pathway is an intercellular signaling mechanism that is essential for proper embryonic development. Members of the Notch protein family are transmembrane receptors that are critical for various cell fate decisions. JAG2 is one of several ligands that activate Notch and related receptors. The Notch signaling pathway is an intercellular signaling mechanism that is essential for proper embryonic development. Members of the Notch gene family encode transmembrane receptors that are critical for various cell fate decisions. The protein encoded by this gene is one of several ligands that activate Notch and related receptors. Two transcript variants encoding different isoforms have been found for this gene.
Product Categories/Family for anti-JAG2 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
130kDa
NCBI Official Full Name
protein jagged-2 isoform a
NCBI Official Synonym Full Names
jagged canonical Notch ligand 2
NCBI Official Symbol
JAG2
NCBI Official Synonym Symbols
HJ2; SER2
NCBI Protein Information
protein jagged-2
UniProt Protein Name
Protein jagged-2
Protein Family
UniProt Gene Name
JAG2
UniProt Synonym Gene Names
Jagged2; hJ2
NCBI Description
The Notch signaling pathway is an intercellular signaling mechanism that is essential for proper embryonic development. Members of the Notch gene family encode transmembrane receptors that are critical for various cell fate decisions. The protein encoded by this gene is one of several ligands that activate Notch and related receptors. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]
Uniprot Description
Putative Notch ligand involved in the mediation of Notch signaling. Involved in limb development ().
Research Articles on JAG2
Similar Products
Product Notes
The JAG2 jag2 (Catalog #AAA3207698) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The JAG2 antibody - N-terminal region reacts with Tested Reactivity: Human Predicted Reactivity: Human, Mouse, Pig, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's JAG2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB), Immunohistochemistry (IHC). Researchers should empirically determine the suitability of the JAG2 jag2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: RAQGRGRLPR RLLLLLALWV QAARPMGYFE LQLSALRNVN GELLSGACCD. It is sometimes possible for the material contained within the vial of "JAG2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
