Rabbit anti-Human TREM1 Polyclonal Antibody | anti-TREM1 antibody

TREM1 Antibody - middle region

Cat. Num. AAA3222334

• Gene Names: TREM1; CD354; TREM-1
• Reactivity: Human
• Applications: Western Blot
• Purity: Affinity purified
• Synonyms: TREM1; Polyclonal Antibody; TREM1 Antibody - middle region; anti-TREM1 antibody

• Host: Rabbit
• Reactivity: Human
• Clonality: Polyclonal
• Purity/Purification: Affinity purified
• Form/Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Sequence: Synthetic peptide located within the following region: MVNLQVEDSGLYQCVIYQPPKEPHMLFDRIRLVVTKGFSGTPGSNENSTQ
• Sequence Length: 234

• Applicable Applications for anti-TREM1 antibody: Western Blot (WB)
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human TREM1
• Preparation and Storage: For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: TREM1Sample Tissue: Human COLO205 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Related Product Information for anti-TREM1 antibody

This gene encodes a receptor belonging to the Ig superfamily that is expressed on myeloid cells. This protein amplifies neutrophil and monocyte-mediated inflammatory responses triggered by bacterial and fungal infections by stimulating release of pro-inflammatory chemokines and cytokines, as well as increased surface expression of cell activation markers. Alternatively spliced transcript variants encoding different isoforms have been noted for this gene.

Product Categories/Family for anti-TREM1 antibody

Polyclonal; Immunology

NCBI and Uniprot Product Information

• NCBI GI #: 336088680
• NCBI GeneID: 54210
• NCBI Accession #: NP_001229518.1
• NCBI GenBank Nucleotide #: NM_001242589.1
• UniProt Accession #: Q9NP99
• Molecular Weight: 26 kDa
• NCBI Official Full Name: triggering receptor expressed on myeloid cells 1 isoform 2
• NCBI Official Synonym Full Names: triggering receptor expressed on myeloid cells 1
• NCBI Official Symbol: TREM1
• NCBI Official Synonym Symbols: CD354; TREM-1
• NCBI Protein Information: triggering receptor expressed on myeloid cells 1
• UniProt Protein Name: Triggering receptor expressed on myeloid cells 1
• Protein Family: Triggering receptor expressed on myeloid cells
• UniProt Gene Name: TREM1
• UniProt Synonym Gene Names: TREM-1
• UniProt Entry Name: TREM1_HUMAN

NCBI Description

This gene encodes a receptor belonging to the Ig superfamily that is expressed on myeloid cells. This protein amplifies neutrophil and monocyte-mediated inflammatory responses triggered by bacterial and fungal infections by stimulating release of pro-inflammatory chemokines and cytokines, as well as increased surface expression of cell activation markers. Alternatively spliced transcript variants encoding different isoforms have been noted for this gene.[provided by RefSeq, Jun 2011]

Uniprot Description

TREM1: Stimulates neutrophil and monocyte-mediated inflammatory responses. Triggers release of pro-inflammatory chemokines and cytokines, as well as increased surface expression of cell activation markers. Amplifier of inflammatory responses that are triggered by bacterial and fungal infections and is a crucial mediator of septic shock. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, integral; Receptor, misc.

Chromosomal Location of Human Ortholog: 6p21.1

Cellular Component: extracellular region; integral to membrane; plasma membrane

Molecular Function: receptor activity

Biological Process: neutrophil chemotaxis; innate immune response; cytokine secretion during immune response; blood coagulation; leukocyte migration; chemokine metabolic process; humoral immune response