Mouse anti-Human PATZ1 Monoclonal Antibody | anti-PATZ1 antibody

PATZ1 (POZ-, AT Hook-, and Zinc Finger-containing Protein 1, BTB/POZ Domain Zinc Finger Transcription Factor, Protein Kinase A RI Subunit alpha-associated Protein, Zinc Finger and BTB Domain-containing Protein 19, Zinc Finger Protein 278, Zinc Finger Sarc

Cat. Num. AAA6010962

• Gene Names: PATZ1; ZSG; MAZR; PATZ; RIAZ; ZBTB19; ZNF278; dJ400N23
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Affinity Purified; Purified by Protein A affinity chromatography.
• Synonyms: PATZ1; Monoclonal Antibody; PATZ1 (POZ-; AT Hook-; and Zinc Finger-containing Protein 1; BTB/POZ Domain Zinc Finger Transcription Factor; Protein Kinase A RI Subunit alpha-associated Protein; Zinc Finger and BTB Domain-containing Protein 19; Zinc Finger Protein 278; Zinc Finger Sarc; Anti -PATZ1 (POZ-; anti-PATZ1 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2b,k
• Clone Number: 1B2
• Specificity: Recognizes human PATZ1.
• Purity/Purification: Affinity Purified; Purified by Protein A affinity chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2.
• Sequence: PLTGKRGRGRPRKANLLDSMFGSPGGLREAGILPCGLCGKVFTDANRLRQHEAQHGVTSLQLGYIDLPPPRLGENGLPISEDPDGPRKRSRTRKQVACE*

• Applicable Applications for anti-PATZ1 antibody: ELISA (EL/EIA), Western Blot (WB)
• Application Notes: Suitable for use in ELISA and Western Blot.
• Immunogen: Partial recombinant corresponding to aa260-359 from PATZ1 (NP_114440) with GST tag. MW of the GST tag alone is 26kD.
• Preparation and Storage: May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37kD).)

Western Blot (WB)

(Western Blot analysis of PATZ1 expression in transfected 293T cell line by PATZ1 monoclonal antibody.|Lane 1: PATZ1 transfected lysate (Predicted MW: 57.6kD).|Lane 2: Non-transfected lysate.)

Testing Data

(Detection limit for recombinant GST tagged PATZ1 is 0.1ng/ml as a capture antibody.)

Related Product Information for anti-PATZ1 antibody

PATZ1 contains an A-T hook DNA binding motif which usually binds to other DNA binding structures to play an important role in chromatin modeling and transcription regulation. Its Poz domain is thought to function as a site for protein-protein interaction and is required for transcriptional repression, and the zinc fingers comprise the DNA binding domain. Since the encoded protein has typical features of a transcription factor, it is postulated to be a repressor of gene expression. In small round cell sarcoma, this gene is fused to EWS by a small inversion of 22q, then the hybrid is thought to be translocated (t(1;22)(p36.1;q12). The protein encoded by this gene contains an A-T hook DNA binding motif which usually binds to other DNA binding structures to play an important role in chromatin modeling and transcription regulation. Its Poz domain is thought to function as a site for protein-protein interaction and is required for transcriptional repression, and the zinc fingers comprise the DNA binding domain. Since the encoded protein has typical features of a transcription factor, it is postulated to be a repressor of gene expression. In small round cell sarcoma, this gene is fused to EWS by a small inversion of 22q, then the hybrid is thought to be translocated (t(1;22)(p36.1;q12). The rearrangement of chromosome 22 involves intron 8 of EWS and exon 1 of this gene creating a chimeric sequence containing the transactivation domain of EWS fused to zinc finger domain of this protein. This is a distinct example of an intra chromosomal rearrangement of chromosome 22. Four alternatively spliced transcript variants are described for this gene.

Product Categories/Family for anti-PATZ1 antibody

Antibodies; Abs to Transcription Factors; Zinc (Ring) Finger

NCBI and Uniprot Product Information

• NCBI GI #: 14670366
• NCBI GeneID: 23598
• NCBI Accession #: NP_114441.1
• NCBI GenBank Nucleotide #: NM_032052.1
• UniProt Accession #: Q9HBE1; Q9HBE2; Q9HBE3; Q9P1A9; Q9UDU0; Q9Y529
• Molecular Weight: 74,060 Da
• NCBI Official Full Name: POZ-, AT hook-, and zinc finger-containing protein 1 long B isoform
• NCBI Official Synonym Full Names: POZ (BTB) and AT hook containing zinc finger 1
• NCBI Official Symbol: PATZ1
• NCBI Official Synonym Symbols: ZSG; MAZR; PATZ; RIAZ; ZBTB19; ZNF278; dJ400N23
• NCBI Protein Information: POZ-, AT hook-, and zinc finger-containing protein 1; MAZ-related factor; zinc finger protein 278; POZ-AT hook-zinc finger protein; zinc finger sarcoma gene protein; BTB-POZ domain zinc finger transcription factor; BTB/POZ domain zinc finger transcription factor; zinc finger and BTB domain-containing protein 19; protein kinase A RI subunit alpha-associated protein
• UniProt Protein Name: POZ-, AT hook-, and zinc finger-containing protein 1
• Protein Family: POZ-, AT hook-, and zinc finger-containing protein
• UniProt Gene Name: PATZ1
• UniProt Synonym Gene Names: PATZ; RIAZ; ZBTB19; ZNF278; ZSG
• UniProt Entry Name: PATZ1_HUMAN

NCBI Description

The protein encoded by this gene contains an A-T hook DNA binding motif which usually binds to other DNA binding structures to play an important role in chromatin modeling and transcription regulation. Its Poz domain is thought to function as a site for protein-protein interaction and is required for transcriptional repression, and the zinc-fingers comprise the DNA binding domain. Since the encoded protein has typical features of a transcription factor, it is postulated to be a repressor of gene expression. In small round cell sarcoma, this gene is fused to EWS by a small inversion of 22q, then the hybrid is thought to be translocated (t(1;22)(p36.1;q12). The rearrangement of chromosome 22 involves intron 8 of EWS and exon 1 of this gene creating a chimeric sequence containing the transactivation domain of EWS fused to zinc finger domain of this protein. This is a distinct example of an intra-chromosomal rearrangement of chromosome 22. Four alternatively spliced transcript variants are described for this gene. [provided by RefSeq, Jul 2008]

Uniprot Description

PATZ1: Transcriptional repressor. A chromosomal aberration involving PATZ1 is associated with small round cell sarcoma. Translocation t(1;22)(p36.1;q12) with EWSR1. Belongs to the krueppel C2H2-type zinc-finger protein family. 4 isoforms of the human protein are produced by alternative splicing.

Protein type: Transcription factor; C2H2-type zinc finger protein; Oncoprotein; DNA-binding

Chromosomal Location of Human Ortholog: 22q12.2

Cellular Component: nucleoplasm; cytoplasm; nucleus

Molecular Function: DNA binding; metal ion binding; chromatin binding

Biological Process: regulation of transcription, DNA-dependent; transcription, DNA-dependent; positive regulation of transcription, DNA-dependent; male gonad development; spermatogenesis; negative regulation of transcription, DNA-dependent; T cell differentiation