Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Lanes:Lane 1: 10ug Tradd-HA-Strep-stable expression 293TREXFlpIn cells-Doxycycline inducedLane 2: 10ug ITradd-HA-Strep-stable expression 293TREXFlpIn cells-non-inducedLane 3: 10ug siRNA scrambled-MDA-MB-231 cellsLane 4: siRNA Tradd-MDA-MB-231 cellsPrimary Antibody Dilution:1:1000Secondary Antibody:Anti-rabbit HRPSecondary Antibody Dilution:1:2000Gene Name:TRADDSubmitted by:Dr. Tencho Tenev, The Breakthrough Breast Cancer Research Centre, Institute of Cancer ResearchThere is BioGPS gene expression data showing that TRADD is expressed in HEK293T)

Rabbit TRADD Polyclonal Antibody | anti-TRADD antibody

TRADD antibody - middle region

Gene Names
TRADD; Hs.89862
Reactivity
Dog, Horse, Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
TRADD; Polyclonal Antibody; TRADD antibody - middle region; anti-TRADD antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Dog, Horse, Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: YEQAFQLLRRFVQAEGRRATLQRLVEALEENELTSLAEDLLGLTDPNGGL
Sequence Length
312
Applicable Applications for anti-TRADD antibody
Western Blot (WB)
Homology
Dog: 76%; Horse: 76%; Human: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human TRADD
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Lanes:Lane 1: 10ug Tradd-HA-Strep-stable expression 293TREXFlpIn cells-Doxycycline inducedLane 2: 10ug ITradd-HA-Strep-stable expression 293TREXFlpIn cells-non-inducedLane 3: 10ug siRNA scrambled-MDA-MB-231 cellsLane 4: siRNA Tradd-MDA-MB-231 cellsPrimary Antibody Dilution:1:1000Secondary Antibody:Anti-rabbit HRPSecondary Antibody Dilution:1:2000Gene Name:TRADDSubmitted by:Dr. Tencho Tenev, The Breakthrough Breast Cancer Research Centre, Institute of Cancer ResearchThere is BioGPS gene expression data showing that TRADD is expressed in HEK293T)

Western Blot (WB) (Lanes:Lane 1: 10ug Tradd-HA-Strep-stable expression 293TREXFlpIn cells-Doxycycline inducedLane 2: 10ug ITradd-HA-Strep-stable expression 293TREXFlpIn cells-non-inducedLane 3: 10ug siRNA scrambled-MDA-MB-231 cellsLane 4: siRNA Tradd-MDA-MB-231 cellsPrimary Antibody Dilution:1:1000Secondary Antibody:Anti-rabbit HRPSecondary Antibody Dilution:1:2000Gene Name:TRADDSubmitted by:Dr. Tencho Tenev, The Breakthrough Breast Cancer Research Centre, Institute of Cancer ResearchThere is BioGPS gene expression data showing that TRADD is expressed in HEK293T)
Related Product Information for anti-TRADD antibody
This is a rabbit polyclonal antibody against TRADD. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: TRADD is the adapter molecule for TNFRSF1A/TNFR1 that specifically associates with the cytoplasmic domain of activated TNFRSF1A/TNFR1 mediating its interaction with FADD. Overexpression of TRADD leads to two major TNF-induced responses, apoptosis and activation of NF-kappa-B.The protein encoded by this gene is a death domain containing adaptor molecule that interacts with TNFRSF1A/TNFR1 and mediates programmed cell death signaling and NF-kappaB activation. This protein binds adaptor protein TRAF2, reduces the recruitment of inhibitor-of-apoptosis proteins (IAPs) by TRAF2, and thus suppresses TRAF2 mediated apoptosis. This protein can also interact with receptor TNFRSF6/FAS and adaptor protein FADD/MORT1, and is involved in the Fas-induced cell death pathway. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Product Categories/Family for anti-TRADD antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
34kDa
NCBI Official Full Name
tumor necrosis factor receptor type 1-associated DEATH domain protein
NCBI Official Synonym Full Names
TNFRSF1A associated via death domain
NCBI Official Symbol
TRADD
NCBI Official Synonym Symbols
Hs.89862
NCBI Protein Information
tumor necrosis factor receptor type 1-associated DEATH domain protein
UniProt Protein Name
Tumor necrosis factor receptor type 1-associated DEATH domain protein
UniProt Gene Name
TRADD
UniProt Synonym Gene Names
TNFR1-associated DEATH domain protein
UniProt Entry Name
TRADD_HUMAN

NCBI Description

The protein encoded by this gene is a death domain containing adaptor molecule that interacts with TNFRSF1A/TNFR1 and mediates programmed cell death signaling and NF-kappaB activation. This protein binds adaptor protein TRAF2, reduces the recruitment of inhibitor-of-apoptosis proteins (IAPs) by TRAF2, and thus suppresses TRAF2 mediated apoptosis. This protein can also interact with receptor TNFRSF6/FAS and adaptor protein FADD/MORT1, and is involved in the Fas-induced cell death pathway. [provided by RefSeq, Jul 2008]

Uniprot Description

TRADD: Adapter molecule for TNFRSF1A/TNFR1 that specifically associates with the cytoplasmic domain of activated TNFRSF1A/TNFR1 mediating its interaction with FADD. Overexpression of TRADD leads to two major TNF-induced responses, apoptosis and activation of NF-kappa-B. Heterodimer with TNFRSF1A/TNFR1. Interacts with DAB2IP, FADD, HIPK2, KRT14, KRT16, KRT17, KRT18, RIPK1, SQSTM1, TRAF1, TRAF2 and TRPC4AP. Found in all examined tissues.

Protein type: Adaptor/scaffold; Apoptosis

Chromosomal Location of Human Ortholog: 16q22

Cellular Component: cytoskeleton; cytoplasm; nucleus; cytosol; receptor complex; lipid raft

Molecular Function: identical protein binding; signal transducer activity; protein binding; protein complex binding; tumor necrosis factor receptor binding; kinase binding; molecular adaptor activity

Biological Process: caspase activation; positive regulation of hair follicle development; positive regulation of I-kappaB kinase/NF-kappaB cascade; induction of apoptosis via death domain receptors; tumor necrosis factor-mediated signaling pathway; protein heterooligomerization; apoptosis; positive regulation of apoptosis; signal transduction; activation of NF-kappaB transcription factor

Research Articles on TRADD

Similar Products

Product Notes

The TRADD tradd (Catalog #AAA3224341) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TRADD antibody - middle region reacts with Dog, Horse, Human and may cross-react with other species as described in the data sheet. AAA Biotech's TRADD can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the TRADD tradd for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: YEQAFQLLRR FVQAEGRRAT LQRLVEALEE NELTSLAEDL LGLTDPNGGL. It is sometimes possible for the material contained within the vial of "TRADD, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.