Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-TPP2 AntibodyTitration: 1.0 ug/mlPositive Control: Jurkat Whole CellTPP2 is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells)

Rabbit TPP2 Polyclonal Antibody | anti-TPP2 antibody

TPP2 Antibody - N-terminal region

Gene Names
TPP2; TPP-2; TPPII; TPP-II
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
TPP2; Polyclonal Antibody; TPP2 Antibody - N-terminal region; anti-TPP2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: GAPGMQVTTDGKPKIVDIIDTTGSGDVNTATEVEPKDGEIVGLSGRVLKI
Sequence Length
1249
Applicable Applications for anti-TPP2 antibody
Western Blot (WB)
Homology
Cow: 93%; Dog: 93%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of Human TPP2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-TPP2 AntibodyTitration: 1.0 ug/mlPositive Control: Jurkat Whole CellTPP2 is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells)

Western Blot (WB) (WB Suggested Anti-TPP2 AntibodyTitration: 1.0 ug/mlPositive Control: Jurkat Whole CellTPP2 is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells)
Related Product Information for anti-TPP2 antibody
This is a rabbit polyclonal antibody against TPP2. It was validated on Western Blot

Target Description: This gene encodes a mammalian peptidase that, at neutral pH, removes tripeptides from the N terminus of longer peptides. The protein has a specialized function that is essential for some MHC class I antigen presentation. The protein is a high molecular mass serine exopeptidase; the amino acid sequence surrounding the serine residue at the active site is similar to the peptidases of the subtilisin class rather than the trypsin class.
Product Categories/Family for anti-TPP2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
138kDa
NCBI Official Full Name
tripeptidyl-peptidase 2 isoform 1
NCBI Official Synonym Full Names
tripeptidyl peptidase 2
NCBI Official Symbol
TPP2
NCBI Official Synonym Symbols
TPP-2; TPPII; TPP-II
NCBI Protein Information
tripeptidyl-peptidase 2
UniProt Protein Name
Tripeptidyl-peptidase 2
Protein Family
UniProt Gene Name
TPP2
UniProt Synonym Gene Names
TPP-2; TPP-II

NCBI Description

This gene encodes a mammalian peptidase that, at neutral pH, removes tripeptides from the N terminus of longer peptides. The protein has a specialized function that is essential for some MHC class I antigen presentation. The protein is a high molecular mass serine exopeptidase; the amino acid sequence surrounding the serine residue at the active site is similar to the peptidases of the subtilisin class rather than the trypsin class. [provided by RefSeq, Jul 2008]

Uniprot Description

TPP2: Component of the proteolytic cascade acting downstream of the 26S proteasome in the ubiquitin-proteasome pathway. May be able to complement the 26S proteasome function to some extent under conditions in which the latter is inhibited. Belongs to the peptidase S8 family.

Protein type: EC 3.4.14.10; Protease

Chromosomal Location of Human Ortholog: 13q33.1

Cellular Component: cytoplasm; cytosol; nucleus

Molecular Function: aminopeptidase activity; endopeptidase activity; protein binding; serine-type endopeptidase activity

Biological Process: protein polyubiquitination

Research Articles on TPP2

Similar Products

Product Notes

The TPP2 tpp2 (Catalog #AAA3216885) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TPP2 Antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's TPP2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the TPP2 tpp2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: GAPGMQVTTD GKPKIVDIID TTGSGDVNTA TEVEPKDGEI VGLSGRVLKI. It is sometimes possible for the material contained within the vial of "TPP2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.