Western Blot (WB)
(Western blot analysis of extracts of various cell lines, using TPD52L3 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (MBS128200) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 30S.)
Rabbit anti-Mouse, Rat TPD52L3 Polyclonal Antibody | anti-TPD52L3 antibody
TPD52L3 Polyclonal Antibody
Gene Names
TPD52L3; hD55; NYDSP25
Reactivity
Mouse, Rat
Applications
Western Blot
Purity
Affinity Purification
Synonyms
TPD52L3; Polyclonal Antibody; TPD52L3 Polyclonal Antibody; hD55; NYDSP25; anti-TPD52L3 antibody
Host
Rabbit
Reactivity
Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity Purification
Sequence
MPHARTETSVGTYESHSTSELEDLTEPEQRELKTKLTKLEAEIVTLRHVLAAKERRCGELKRKLGLTALVGLRQNLSKSWLDVQVSNTYVKQKTSAALSTMGTLICRKLGGVKKSATLRSFEGNPKGEGSRI
Sequence Length
136
Applicable Applications for anti-TPD52L3 antibody
Western Blot (WB)
Application Notes
WB: 1:200 - 1:2000
Immunogen
Recombinant protein of human TPD52L3
Immunogen Species
Human
Storage Buffer
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Positive Samples
Mouse brain, Rat brain
Preparation and Storage
Store at -20 degree C. Avoid freeze / thaw cycles.
Western Blot (WB)
(Western blot analysis of extracts of various cell lines, using TPD52L3 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (MBS128200) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 30S.)
Western Blot (WB)
(Western blot analysis of extracts of various cell lines, using TPD52L3 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (MBS128200) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 30S.)
Related Product Information for anti-TPD52L3 antibody
This gene encodes a member of the tumor protein D52-like family of proteins. These proteins are characterized by an N-terminal coiled-coil motif that is used to form homo- and heteromeric complexes with other tumor protein D52-like proteins. The encoded protein may play a role in spermatogenesis. Alternative splicing results in multiple transcript variants.
Product Categories/Family for anti-TPD52L3 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
Calculated: 14kDa; 15kDa
Observed: 14kDa
Observed: 14kDa
NCBI Official Full Name
tumor protein D55 isoform 2
NCBI Official Synonym Full Names
tumor protein D52 like 3
NCBI Official Symbol
TPD52L3
NCBI Official Synonym Symbols
hD55; NYDSP25
NCBI Protein Information
tumor protein D55
UniProt Protein Name
Tumor protein D55
Protein Family
UniProt Gene Name
TPD52L3
UniProt Synonym Gene Names
hD55
NCBI Description
This gene encodes a member of the tumor protein D52-like family of proteins. These proteins are characterized by an N-terminal coiled-coil motif that is used to form homo- and heteromeric complexes with other tumor protein D52-like proteins. The encoded protein may play a role in spermatogenesis. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Oct 2009]
Similar Products
Product Notes
The TPD52L3 tpd52l3 (Catalog #AAA9135531) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TPD52L3 Polyclonal Antibody reacts with Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's TPD52L3 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1:200 - 1:2000. Researchers should empirically determine the suitability of the TPD52L3 tpd52l3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MPHARTETSV GTYESHSTSE LEDLTEPEQR ELKTKLTKLE AEIVTLRHVL AAKERRCGEL KRKLGLTALV GLRQNLSKSW LDVQVSNTYV KQKTSAALST MGTLICRKLG GVKKSATLRS FEGNPKGEGS RI. It is sometimes possible for the material contained within the vial of "TPD52L3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
