Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of TP53I3 expression in transfected 293T cell line by TP53I3 MaxPab polyclonal antibody.Lane 1: TP53I3 transfected lysate(36.63 KDa).Lane 2: Non-transfected lysate.)

Rabbit anti-Human TP53I3 Polyclonal Antibody | anti-TP53I3 antibody

TP53I3 (Tumor Protein p53 Inducible Protein 3, PIG3) (APC)

Gene Names
TP53I3; PIG3
Reactivity
Human
Applications
Western Blot
Purity
Purified
Synonyms
TP53I3; Polyclonal Antibody; TP53I3 (Tumor Protein p53 Inducible Protein 3; PIG3) (APC); Tumor Protein p53 Inducible Protein 3; PIG3; anti-TP53I3 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human TP53I3.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Applicable Applications for anti-TP53I3 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
TP53I3 (AAH00474.1, 1aa-332aa) full-length human protein.
Immunogen Sequence
MLAVHFDKPGGPENLYVKEVAKPSPGEGEVLLKVAASALNRADLMQRQGQYDPPPGASNILGLEASGHVAELGPGCQGHWKIGDTAMALLPGGGQAQYVTVPEGLLMPIPEGLTLTQIPEAWLTAFQLLHLVGNVQAGDYVLIHAGLSGVGTAAIQLTRMAGAIPLVTAGSQKKLQMAEKLGGFNYKKEDFSEATLKFTKGAGVNLILDCIGGSYWEKNVNCLALDGRWVLYGLMGGGDINGPLFSKLLFKRGSLITSLLRSRDNKYKQMLVNAFTEQILPHFSTEGPQRLLPVLDRIYPVTEIQEAHKYMEANKNIGKIVLELPQ
Conjugate
APC
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of TP53I3 expression in transfected 293T cell line by TP53I3 MaxPab polyclonal antibody.Lane 1: TP53I3 transfected lysate(36.63 KDa).Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of TP53I3 expression in transfected 293T cell line by TP53I3 MaxPab polyclonal antibody.Lane 1: TP53I3 transfected lysate(36.63 KDa).Lane 2: Non-transfected lysate.)
Related Product Information for anti-TP53I3 antibody
The protein encoded by this gene is similar to oxidoreductases, which are enzymes involved in cellular responses to oxidative stresses and irradiation. This gene is induced by the tumor suppressor p53 and is thought to be involved in p53-mediated cell death. It contains a p53 consensus binding site in its promoter region and a downstream pentanucleotide microsatellite sequence. P53 has been shown to transcriptionally activate this gene by interacting with the downstream pentanucleotide microsatellite sequence. The microsatellite is polymorphic, with a varying number of pentanucleotide repeats directly correlated with the extent of transcriptional activation by p53. It has been suggested that the microsatellite polymorphism may be associated with differential susceptibility to cancer. At least two transcript variants encoding the same protein have been found for this gene. [provided by RefSeq]
Product Categories/Family for anti-TP53I3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
25,402 Da
NCBI Official Full Name
Tumor protein p53 inducible protein 3
NCBI Official Synonym Full Names
tumor protein p53 inducible protein 3
NCBI Official Symbol
TP53I3
NCBI Official Synonym Symbols
PIG3
NCBI Protein Information
quinone oxidoreductase PIG3; p53-induced gene 3 protein; quinone oxidoreductase homolog
Protein Family

NCBI Description

The protein encoded by this gene is similar to oxidoreductases, which are enzymes involved in cellular responses to oxidative stresses and irradiation. This gene is induced by the tumor suppressor p53 and is thought to be involved in p53-mediated cell death. It contains a p53 consensus binding site in its promoter region and a downstream pentanucleotide microsatellite sequence. P53 has been shown to transcriptionally activate this gene by interacting with the downstream pentanucleotide microsatellite sequence. The microsatellite is polymorphic, with a varying number of pentanucleotide repeats directly correlated with the extent of transcriptional activation by p53. It has been suggested that the microsatellite polymorphism may be associated with differential susceptibility to cancer. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, May 2011]

Research Articles on TP53I3

Similar Products

Product Notes

The TP53I3 (Catalog #AAA6451774) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TP53I3 (Tumor Protein p53 Inducible Protein 3, PIG3) (APC) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's TP53I3 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the TP53I3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "TP53I3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.