Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-TOX Antibody Titration: 0.2-1 ug/mlPositive Control: Jurkat cell lysateTOX is supported by BioGPS gene expression data to be expressed in Jurkat)

Rabbit TOX Polyclonal Antibody | anti-TOX antibody

TOX antibody - N-terminal region

Gene Names
TOX; TOX1
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
TOX; Polyclonal Antibody; TOX antibody - N-terminal region; anti-TOX antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: CLDPYYCNKFDGENMYMSMTEPSQDYVPASQSYPGPSLESEDFNIPPITP
Sequence Length
526
Applicable Applications for anti-TOX antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 92%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human TOX
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-TOX Antibody Titration: 0.2-1 ug/mlPositive Control: Jurkat cell lysateTOX is supported by BioGPS gene expression data to be expressed in Jurkat)

Western Blot (WB) (WB Suggested Anti-TOX Antibody Titration: 0.2-1 ug/mlPositive Control: Jurkat cell lysateTOX is supported by BioGPS gene expression data to be expressed in Jurkat)
Related Product Information for anti-TOX antibody
This is a rabbit polyclonal antibody against TOX. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: Some high-mobility group (HMG) box proteins (e.g., LEF1) contain a single HMG box motif and bind DNA in a sequence-specific manner, while other members of this family (e.g., HMG1) have multiple HMG boxes and bind DNA in a sequence-independent but structure-dependent manner. All HMG box proteins are able to induce a sharp bend in DNA. TOX contains a single HMG box motif.Some high-mobility group (HMG) box proteins (e.g., LEF1; MIM 153245) contain a single HMG box motif and bind DNA in a sequence-specific manner, while other members of this family (e.g., HMG1; MIM 163905) have multiple HMG boxes and bind DNA in a sequence-independent but structure-dependent manner. All HMG box proteins are able to induce a sharp bend in DNA. TOX contains a single HMG box motif.[supplied by OMIM].
Product Categories/Family for anti-TOX antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
58kDa
NCBI Official Full Name
thymocyte selection-associated high mobility group box protein TOX
NCBI Official Synonym Full Names
thymocyte selection associated high mobility group box
NCBI Official Symbol
TOX
NCBI Official Synonym Symbols
TOX1
NCBI Protein Information
thymocyte selection-associated high mobility group box protein TOX
UniProt Protein Name
Thymocyte selection-associated high mobility group box protein TOX
Protein Family
UniProt Gene Name
TOX
UniProt Synonym Gene Names
KIAA0808
UniProt Entry Name
TOX_HUMAN

NCBI Description

The protein encoded by this gene contains a HMG box DNA binding domain. HMG boxes are found in many eukaryotic proteins involved in chromatin assembly, transcription and replication. This protein may function to regulate T-cell development.[provided by RefSeq, Apr 2009]

Uniprot Description

TOX: May play a role in regulating T-cell development.

Protein type: DNA-binding

Chromosomal Location of Human Ortholog: 8q12.1

Cellular Component: nucleus

Molecular Function: DNA binding; chromatin binding

Biological Process: chromatin remodeling; regulation of transcription, DNA-dependent

Research Articles on TOX

Similar Products

Product Notes

The TOX tox (Catalog #AAA3201674) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TOX antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's TOX can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the TOX tox for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: CLDPYYCNKF DGENMYMSMT EPSQDYVPAS QSYPGPSLES EDFNIPPITP. It is sometimes possible for the material contained within the vial of "TOX, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.