Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-NCKAP1L Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Jurkat cell lysateNCKAP1L is supported by BioGPS gene expression data to be expressed in Jurkat)

Rabbit NCKAP1L Polyclonal Antibody | anti-NCKAP1L antibody

NCKAP1L antibody - N-terminal region

Gene Names
NCKAP1L; HEM1
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
NCKAP1L; Polyclonal Antibody; NCKAP1L antibody - N-terminal region; anti-NCKAP1L antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: CSDPKSKPPFLLEKSMEPSLKYINKKFPNIDVRNSTQHLGPVHREKAEII
Sequence Length
1127
Applicable Applications for anti-NCKAP1L antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 92%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human NCKAP1L
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-NCKAP1L Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Jurkat cell lysateNCKAP1L is supported by BioGPS gene expression data to be expressed in Jurkat)

Western Blot (WB) (WB Suggested Anti-NCKAP1L Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Jurkat cell lysateNCKAP1L is supported by BioGPS gene expression data to be expressed in Jurkat)
Related Product Information for anti-NCKAP1L antibody
This is a rabbit polyclonal antibody against NCKAP1L. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: NCKAP1L is a member of the HEM family of tissue-specific transmembrane proteins which are highly conserved from invertebrates through mammals. This gene is only expressed in hematopoietic cells, while hematopoietic protein 2 is preferentially expressed in brain, heart, liver and testis. The function of the HEM1 product has not been established but it is thought to play an essential role in oogenesis.The protein encoded by this gene is a member of the HEM family of tissue-specific transmembrane proteins which are highly conserved from invertebrates through mammals. This gene is only expressed in hematopoietic cells, while hematopoietic protein 2 is preferentially expressed in brain, heart, liver and testis. The function of the HEM1 product has not been established but it is thought to play an essential role in oogenesis.
Product Categories/Family for anti-NCKAP1L antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
128kDa
NCBI Official Full Name
nck-associated protein 1-like isoform 1
NCBI Official Synonym Full Names
NCK associated protein 1 like
NCBI Official Symbol
NCKAP1L
NCBI Official Synonym Symbols
HEM1
NCBI Protein Information
nck-associated protein 1-like
UniProt Protein Name
Nck-associated protein 1-like
Protein Family
UniProt Gene Name
NCKAP1L
UniProt Synonym Gene Names
HEM1
UniProt Entry Name
NCKPL_HUMAN

NCBI Description

This gene encodes a member of the HEM family of tissue-specific transmembrane proteins which are highly conserved from invertebrates through mammals. This gene is only expressed in hematopoietic cells. The encoded protein is a part of the Scar/WAVE complex which plays an important role in regulating cell shape in both metazoans and plants. Alternatively spliced transcript variants encoding different isoforms have been found.[provided by RefSeq, May 2010]

Uniprot Description

HEM1: a component of the Scar/WAVE complex that plays an important role in regulating cell shape and motility. Found at elevated levels in cells of hematopoietic lineage. Localizes to propagating waves at the leading edge of a motile human neutrophils. The complex stimulates actin assembly; polymerized actin is reciprocally required to remove the complex from the membrane. Overexpression is associated with poor outcome in B-cell chronic lymphocytic leukemia patients.

Protein type: Membrane protein, integral

Chromosomal Location of Human Ortholog: 12q13.1

Cellular Component: membrane; integral to plasma membrane; cytosol

Molecular Function: protein binding; protein complex binding; protein kinase activator activity

Biological Process: response to drug; neutrophil chemotaxis; erythrocyte development; positive regulation of erythrocyte differentiation; myeloid cell homeostasis; positive regulation of cell adhesion mediated by integrin; positive regulation of CD4-positive, alpha beta T cell differentiation; maintenance of cell polarity; chemotaxis; positive regulation of CD8-positive, alpha-beta T cell differentiation; positive regulation of lymphocyte differentiation; B cell receptor signaling pathway; negative regulation of interleukin-17 production; B cell homeostasis; positive regulation of actin filament polymerization; positive regulation of protein kinase activity; negative regulation of interleukin-6 production; positive regulation of B cell proliferation; positive regulation of B cell differentiation; positive regulation of T cell proliferation; T cell homeostasis; protein complex assembly; positive regulation of gamma-delta T cell differentiation; cortical actin cytoskeleton organization and biogenesis; positive regulation of phagocytosis, engulfment; positive regulation of phosphorylation; negative regulation of apoptosis

Research Articles on NCKAP1L

Similar Products

Product Notes

The NCKAP1L nckap1l (Catalog #AAA3208648) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The NCKAP1L antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's NCKAP1L can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the NCKAP1L nckap1l for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: CSDPKSKPPF LLEKSMEPSL KYINKKFPNI DVRNSTQHLG PVHREKAEII. It is sometimes possible for the material contained within the vial of "NCKAP1L, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.