Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (TNNT1 rabbit polyclonal antibody. Western Blot analysis of TNNT1 expression in human placenta.)

Rabbit anti-Human, Mouse TNNT1 Polyclonal Antibody | anti-TNNT1 antibody

TNNT1 (Troponin T, Slow Skeletal Muscle, TnTs, Slow Skeletal Muscle Troponin T, sTnT, TNT, ANM, NEM5) (Biotin)

Gene Names
TNNT1; ANM; TNT; NEM5; STNT; TNTS
Reactivity
Human, Mouse
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
TNNT1; Polyclonal Antibody; TNNT1 (Troponin T; Slow Skeletal Muscle; TnTs; Slow Skeletal Muscle Troponin T; sTnT; TNT; ANM; NEM5) (Biotin); anti-TNNT1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human TNNT1. Species Crossreactivity: mouse.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Applicable Applications for anti-TNNT1 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human TNNT1, aa1-262 (AAH10963.1).
Immunogen Sequence
MSDTEEQEYEEEQPEEEAAEEEEEAPEEPEPVAEPEEERPKPSRPVVPPLIPPKIPEGERVDFDDIHRKRMEKDLLELQTLIDVHFEQRKKEEEELVALKERIERRRSERAEQQRFRTEKERERQAKLAEEKMRKEEEEAKKRAEDDAKKKKVLSNMGAHFGGYLVKAEQKRGKRQTGREMKVRILSERKKPLDIDYMGEEQLREKAQELSDWIHQLESEKFDLMAKLKQQKYEINVLYNRISHAQKFRKGAGKGRVGGRWK
Conjugate
Biotin
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(TNNT1 rabbit polyclonal antibody. Western Blot analysis of TNNT1 expression in human placenta.)

Western Blot (WB) (TNNT1 rabbit polyclonal antibody. Western Blot analysis of TNNT1 expression in human placenta.)

Western Blot (WB)

(TNNT1 rabbit polyclonal antibody. Western Blot analysis of TNNT1 expression in mouse kidney.)

Western Blot (WB) (TNNT1 rabbit polyclonal antibody. Western Blot analysis of TNNT1 expression in mouse kidney.)

Western Blot (WB)

(Western Blot analysis of TNNT1 expression in transfected 293T cell line by TNNT1 polyclonal antibody. Lane 1: TNNT1 transfected lysate (31.2kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of TNNT1 expression in transfected 293T cell line by TNNT1 polyclonal antibody. Lane 1: TNNT1 transfected lysate (31.2kD). Lane 2: Non-transfected lysate.)
Product Categories/Family for anti-TNNT1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
31,242 Da
NCBI Official Full Name
Homo sapiens troponin T type 1 (skeletal, slow), mRNA
NCBI Official Synonym Full Names
troponin T1, slow skeletal type
NCBI Official Symbol
TNNT1
NCBI Official Synonym Symbols
ANM; TNT; NEM5; STNT; TNTS
NCBI Protein Information
troponin T, slow skeletal muscle
Protein Family

NCBI Description

This gene encodes a protein that is a subunit of troponin, which is a regulatory complex located on the thin filament of the sarcomere. This complex regulates striated muscle contraction in response to fluctuations in intracellular calcium concentration. This complex is composed of three subunits: troponin C, which binds calcium, troponin T, which binds tropomyosin, and troponin I, which is an inhibitory subunit. This protein is the slow skeletal troponin T subunit. Mutations in this gene cause nemaline myopathy type 5, also known as Amish nemaline myopathy, a neuromuscular disorder characterized by muscle weakness and rod-shaped, or nemaline, inclusions in skeletal muscle fibers which affects infants, resulting in death due to respiratory insufficiency, usually in the second year. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]

Research Articles on TNNT1

Similar Products

Product Notes

The TNNT1 (Catalog #AAA6396832) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TNNT1 (Troponin T, Slow Skeletal Muscle, TnTs, Slow Skeletal Muscle Troponin T, sTnT, TNT, ANM, NEM5) (Biotin) reacts with Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's TNNT1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the TNNT1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "TNNT1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.