Rabbit anti-Human, Mouse TNNT1 Polyclonal Antibody | anti-TNNT1 antibody

TNNT1 (Troponin T, Slow Skeletal Muscle, TnTs, Slow Skeletal Muscle Troponin T, sTnT, TNT, ANM, NEM5) (Biotin)

Cat. Num. AAA6396832

• Gene Names: TNNT1; ANM; TNT; NEM5; STNT; TNTS
• Reactivity: Human, Mouse
• Applications: Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: TNNT1; Polyclonal Antibody; TNNT1 (Troponin T; Slow Skeletal Muscle; TnTs; Slow Skeletal Muscle Troponin T; sTnT; TNT; ANM; NEM5) (Biotin); anti-TNNT1 antibody

• Host: Rabbit
• Reactivity: Human, Mouse
• Clonality: Polyclonal
• Isotype: IgG
• Specificity: Recognizes human TNNT1. Species Crossreactivity: mouse.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.

• Applicable Applications for anti-TNNT1 antibody: Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Full length human TNNT1, aa1-262 (AAH10963.1).
• Immunogen Sequence: MSDTEEQEYEEEQPEEEAAEEEEEAPEEPEPVAEPEEERPKPSRPVVPPLIPPKIPEGERVDFDDIHRKRMEKDLLELQTLIDVHFEQRKKEEEELVALKERIERRRSERAEQQRFRTEKERERQAKLAEEKMRKEEEEAKKRAEDDAKKKKVLSNMGAHFGGYLVKAEQKRGKRQTGREMKVRILSERKKPLDIDYMGEEQLREKAQELSDWIHQLESEKFDLMAKLKQQKYEINVLYNRISHAQKFRKGAGKGRVGGRWK
• Conjugate: Biotin
• Note: Preservative Free
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(TNNT1 rabbit polyclonal antibody. Western Blot analysis of TNNT1 expression in human placenta.)

Western Blot (WB)

(TNNT1 rabbit polyclonal antibody. Western Blot analysis of TNNT1 expression in mouse kidney.)

Western Blot (WB)

(Western Blot analysis of TNNT1 expression in transfected 293T cell line by TNNT1 polyclonal antibody. Lane 1: TNNT1 transfected lysate (31.2kD). Lane 2: Non-transfected lysate.)

Product Categories/Family for anti-TNNT1 antibody

Antibodies; Cardiac Markers

NCBI and Uniprot Product Information

• NCBI GI #: 15012112
• NCBI GeneID: 7138
• Molecular Weight: 31,242 Da
• NCBI Official Full Name: Homo sapiens troponin T type 1 (skeletal, slow), mRNA
• NCBI Official Synonym Full Names: troponin T1, slow skeletal type
• NCBI Official Symbol: TNNT1
• NCBI Official Synonym Symbols: ANM; TNT; NEM5; STNT; TNTS
• NCBI Protein Information: troponin T, slow skeletal muscle
• Protein Family: Troponin

NCBI Description

This gene encodes a protein that is a subunit of troponin, which is a regulatory complex located on the thin filament of the sarcomere. This complex regulates striated muscle contraction in response to fluctuations in intracellular calcium concentration. This complex is composed of three subunits: troponin C, which binds calcium, troponin T, which binds tropomyosin, and troponin I, which is an inhibitory subunit. This protein is the slow skeletal troponin T subunit. Mutations in this gene cause nemaline myopathy type 5, also known as Amish nemaline myopathy, a neuromuscular disorder characterized by muscle weakness and rod-shaped, or nemaline, inclusions in skeletal muscle fibers which affects infants, resulting in death due to respiratory insufficiency, usually in the second year. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]