Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: TNIKSample Tissue: Human HepG2 Whole CellAntibody Dilution: 1.0ug/ml)

Rabbit anti-Human TNIK Polyclonal Antibody | anti-TNIK antibody

TNIK Antibody - middle region

Gene Names
TNIK; MRT54
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
TNIK; Polyclonal Antibody; TNIK Antibody - middle region; anti-TNIK antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: ETSHADSFSGSISREGTLMIRETSGEKKRSGHSDSNGFAGHINLPDLVQQ
Sequence Length
167
Applicable Applications for anti-TNIK antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human TNIK
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: TNIKSample Tissue: Human HepG2 Whole CellAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: TNIKSample Tissue: Human HepG2 Whole CellAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-TNIK antibody
Germinal center kinases (GCKs), such as TNIK, are characterized by an N-terminal kinase domain and a C-terminal GCK domain that serves a regulatory function (Fu et al., 1999 [PubMed 10521462]).[supplied by OMIM, Mar 2008]
Product Categories/Family for anti-TNIK antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
155 kDa
NCBI Official Full Name
TRAF2 and NCK-interacting protein kinase isoform 2
NCBI Official Synonym Full Names
TRAF2 and NCK interacting kinase
NCBI Official Symbol
TNIK
NCBI Official Synonym Symbols
MRT54
NCBI Protein Information
TRAF2 and NCK-interacting protein kinase
UniProt Protein Name
TRAF2 and NCK-interacting protein kinase
UniProt Gene Name
TNIK
UniProt Synonym Gene Names
KIAA0551
UniProt Entry Name
TNIK_HUMAN

NCBI Description

Wnt signaling plays important roles in carcinogenesis and embryonic development. The protein encoded by this gene is a serine/threonine kinase that functions as an activator of the Wnt signaling pathway. Mutations in this gene are associated with an autosomal recessive form of cognitive disability. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Jul 2017]

Uniprot Description

TNIK: Serine/threonine kinase that acts as an essential activator of the Wnt signaling pathway. Recruited to promoters of Wnt target genes and required to activate their expression. May act by phosphorylating TCF4/TCF7L2. Appears to act upstream of the JUN N-terminal pathway. May play a role in the response to environmental stress. Part of a signaling complex composed of NEDD4, RAP2A and TNIK which regulates neuronal dendrite extension and arborization during development. More generally, it may play a role in cytoskeletal rearrangements and regulate cell spreading. Phosphorylates SMAD1 on Thr-322. Interacts (via the CNH domain) with RAP2A (GTP-bound form preferentially); the interaction is direct and required for the activation of TNIK by RAP2A. Interacts with NEDD4; recruits RAP2A to NEDD4. Interacts with TRAF2 and NCK. Interacts with TCF7L2/TCF4 and CTNNB1; the interaction is direct. Interacts with TANC1. Expressed ubiquitously. Highest levels observed in heart, brain and skeletal muscle. Expressed in normal colonic epithelia and colorectal cancer tissues. Belongs to the protein kinase superfamily. STE Ser/Thr protein kinase family. STE20 subfamily. 8 isoforms of the human protein are produced by alternative splicing.

Protein type: Kinase, protein; Protein kinase, STE; Protein kinase, Ser/Thr (non-receptor); EC 2.7.11.1; STE group; STE20 family; MSN subfamily

Chromosomal Location of Human Ortholog: 3q26.31

Cellular Component: nucleoplasm; recycling endosome; cytoskeleton; apical plasma membrane; cytoplasm; nucleus

Molecular Function: protein serine/threonine kinase activity; protein binding; ATP binding; receptor signaling protein serine/threonine kinase activity; protein kinase activity

Biological Process: microvillus biogenesis; Wnt receptor signaling pathway; protein amino acid autophosphorylation; regulation of dendrite morphogenesis; actin cytoskeleton reorganization; cytoskeleton organization and biogenesis; positive regulation of protein amino acid phosphorylation; protein amino acid phosphorylation; activation of JNKK activity

Research Articles on TNIK

Similar Products

Product Notes

The TNIK tnik (Catalog #AAA3220580) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TNIK Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's TNIK can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the TNIK tnik for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: ETSHADSFSG SISREGTLMI RETSGEKKRS GHSDSNGFAG HINLPDLVQQ. It is sometimes possible for the material contained within the vial of "TNIK, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.