Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: CP27ASample Type: 293T Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

Rabbit CYP27A1 Polyclonal Antibody | anti-CYP27A1 antibody

CYP27A1 Antibody - middle region

Gene Names
CYP27A1; CTX; CP27; CYP27
Reactivity
Cow, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity purified
Synonyms
CYP27A1; Polyclonal Antibody; CYP27A1 Antibody - middle region; anti-CYP27A1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MTRLDQLRAESASGNQVSDMAQLFYYFALEAICYILFEKRIGCLQRSIPE
Sequence Length
531
Applicable Applications for anti-CYP27A1 antibody
Western Blot (WB)
Homology
Cow: 77%; Guinea Pig: 79%; Horse: 86%; Human: 100%; Mouse: 79%; Rabbit: 93%; Rat: 86%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of Human CP27A
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: CP27ASample Type: 293T Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: CP27ASample Type: 293T Whole Cell lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-CYP27A1 antibody
This is a rabbit polyclonal antibody against CP27A. It was validated on Western Blot

Target Description: This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This mitochondrial protein oxidizes cholesterol intermediates as part of the bile synthesis pathway. Since the conversion of cholesterol to bile acids is the major route for removing cholesterol from the body, this protein is important for overall cholesterol homeostasis. Mutations in this gene cause cerebrotendinous xanthomatosis, a rare autosomal recessive lipid storage disease.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
58kDa
NCBI Official Full Name
sterol 26-hydroxylase, mitochondrial
NCBI Official Synonym Full Names
cytochrome P450 family 27 subfamily A member 1
NCBI Official Symbol
CYP27A1
NCBI Official Synonym Symbols
CTX; CP27; CYP27
NCBI Protein Information
sterol 26-hydroxylase, mitochondrial
UniProt Protein Name
Sterol 26-hydroxylase, mitochondrial
Protein Family
UniProt Gene Name
CYP27A1
UniProt Synonym Gene Names
CYP27
UniProt Entry Name
CP27A_HUMAN

NCBI Description

This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This mitochondrial protein oxidizes cholesterol intermediates as part of the bile synthesis pathway. Since the conversion of cholesterol to bile acids is the major route for removing cholesterol from the body, this protein is important for overall cholesterol homeostasis. Mutations in this gene cause cerebrotendinous xanthomatosis, a rare autosomal recessive lipid storage disease. [provided by RefSeq, Jul 2008]

Uniprot Description

CYP27A1: Catalyzes the first step in the oxidation of the side chain of sterol intermediates; the 27-hydroxylation of 5-beta- cholestane-3-alpha,7-alpha,12-alpha-triol. Has also a vitamin D3- 25-hydroxylase activity. Defects in CYP27A1 are the cause of cerebrotendinous xanthomatosis (CTX). CTX is a rare sterol storage disorder characterized clinically by progressive neurologic dysfunction, premature atherosclerosis, and cataracts. Belongs to the cytochrome P450 family.

Protein type: Oxidoreductase; Lipid Metabolism - primary bile acid biosynthesis; EC 1.14.13.15; Mitochondrial

Chromosomal Location of Human Ortholog: 2q35

Cellular Component: mitochondrial matrix; mitochondrial inner membrane

Molecular Function: cholestanetriol 26-monooxygenase activity; iron ion binding; cholesterol 26-hydroxylase activity; heme binding; steroid hydroxylase activity; vitamin D3 25-hydroxylase activity

Biological Process: bile acid biosynthetic process; cholesterol metabolic process; bile acid metabolic process; xenobiotic metabolic process; sterol metabolic process

Disease: Cerebrotendinous Xanthomatosis

Research Articles on CYP27A1

Similar Products

Product Notes

The CYP27A1 cyp27a1 (Catalog #AAA3210425) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CYP27A1 Antibody - middle region reacts with Cow, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's CYP27A1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the CYP27A1 cyp27a1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MTRLDQLRAE SASGNQVSDM AQLFYYFALE AICYILFEKR IGCLQRSIPE. It is sometimes possible for the material contained within the vial of "CYP27A1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.