Western Blot (WB)
(WB Suggested Anti-QPCTL Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:12500Positive Control: 721_B cell lysateQPCTL is supported by BioGPS gene expression data to be expressed in 721_B)
Rabbit QPCTL Polyclonal Antibody | anti-QPCTL antibody
QPCTL antibody - middle region
Gene Names
QPCTL; gQC
Reactivity
Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
QPCTL; Polyclonal Antibody; QPCTL antibody - middle region; anti-QPCTL antibody
Host
Rabbit
Reactivity
Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: QLLFLDGEEALKEWGPKDSLYGSRHLAQLMESIPHSPGPTRIQAIELFML
Sequence Length
382
Applicable Applications for anti-QPCTL antibody
Western Blot (WB)
Homology
Dog: 93%; Guinea Pig: 92%; Horse: 86%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human QPCTL
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-QPCTL Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:12500Positive Control: 721_B cell lysateQPCTL is supported by BioGPS gene expression data to be expressed in 721_B)
Western Blot (WB)
(WB Suggested Anti-QPCTL Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:12500Positive Control: 721_B cell lysateQPCTL is supported by BioGPS gene expression data to be expressed in 721_B)
Related Product Information for anti-QPCTL antibody
This is a rabbit polyclonal antibody against QPCTL. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: QPCTL is a single-pass membrane proteinPotential. It belongs to the glutaminyl-peptide cyclotransferase family. The exact function of QPCTL remains unknown.
Target Description: QPCTL is a single-pass membrane proteinPotential. It belongs to the glutaminyl-peptide cyclotransferase family. The exact function of QPCTL remains unknown.
Product Categories/Family for anti-QPCTL antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
43kDa
NCBI Official Full Name
glutaminyl-peptide cyclotransferase-like protein isoform 1
NCBI Official Synonym Full Names
glutaminyl-peptide cyclotransferase like
NCBI Official Symbol
QPCTL
NCBI Official Synonym Symbols
gQC
NCBI Protein Information
glutaminyl-peptide cyclotransferase-like protein
UniProt Protein Name
Glutaminyl-peptide cyclotransferase-like protein
Protein Family
UniProt Gene Name
QPCTL
UniProt Synonym Gene Names
gQC
UniProt Entry Name
QPCTL_HUMAN
Uniprot Description
Function: Responsible for the biosynthesis of pyroglutamyl peptides. Ref.5 Ref.7
Catalytic activity: L-glutaminyl-peptide = 5-oxoprolyl-peptide + NH3. Ref.5 Ref.7
Cofactor: Binds 1 zinc ion per subunit. Ref.7
Subcellular location: Golgi apparatus membrane; Single-pass type I membrane protein Ref.5.
Sequence similarities: Belongs to the glutaminyl-peptide cyclotransferase family.
Research Articles on QPCTL
Similar Products
Product Notes
The QPCTL qpctl (Catalog #AAA3208520) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The QPCTL antibody - middle region reacts with Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's QPCTL can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the QPCTL qpctl for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: QLLFLDGEEA LKEWGPKDSL YGSRHLAQLM ESIPHSPGPT RIQAIELFML. It is sometimes possible for the material contained within the vial of "QPCTL, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
