Western Blot (WB)
(TMEM195 antibody (MBS5302339) used at 1 ug/ml to detect target protein.)
Rabbit TMEM195 Polyclonal Antibody | anti-TMEM195 antibody
TMEM195 antibody
Gene Names
Agmo; Tmem195; RGD1312038
Applications
Western Blot
Purity
Affinity purified
Synonyms
TMEM195; Polyclonal Antibody; TMEM195 antibody; Polyclonal TMEM195; Anti-TMEM195; TMEM-195; MGC131748; Transmembrane Protein 195; FLJ16237; TMEM 195; anti-TMEM195 antibody
Host
Rabbit
Clonality
Polyclonal
Specificity
TMEM195 antibody was raised against the N terminal of TMEM195
Purity/Purification
Affinity purified
Form/Format
Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of TMEM195 antibody in PBS
Concentration
1 mg/ml (varies by lot)
Sequence Length
447
Applicable Applications for anti-TMEM195 antibody
Western Blot (WB)
Application Notes
WB: 1 ug/ml
Biological Significance
TMEM195 belongs to the TMEM195 family. It is a multi-pass membrane protein.
Cross-Reactivity
Human
Immunogen
TMEM195 antibody was raised using the N terminal of TMEM195 corresponding to a region with amino acids VPDYVKKATPFFISLMLLELVVSWILKGKPPGRLDDALTSISAGVLSRLP
Preparation and Storage
Store at 2-8 degree C for short periods. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Western Blot (WB)
(TMEM195 antibody (MBS5302339) used at 1 ug/ml to detect target protein.)
Western Blot (WB)
(TMEM195 antibody (MBS5302339) used at 1 ug/ml to detect target protein.)
Related Product Information for anti-TMEM195 antibody
Rabbit polyclonal TMEM195 antibody raised against the N terminal of TMEM195
Product Categories/Family for anti-TMEM195 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
Molecular Weight
51 kDa (MW of target protein)
NCBI Official Full Name
Tmem195 protein
NCBI Official Synonym Full Names
alkylglycerol monooxygenase
NCBI Official Symbol
Agmo
NCBI Official Synonym Symbols
Tmem195; RGD1312038
NCBI Protein Information
alkylglycerol monooxygenase
UniProt Protein Name
Alkylglycerol monooxygenase
UniProt Gene Name
Agmo
UniProt Synonym Gene Names
Tmem195
UniProt Entry Name
ALKMO_RAT
Uniprot Description
AGMO: Glyceryl-ether monooxygenase that cleaves the O-alkyl bond of ether lipids. Ether lipids are essential components of brain membranes. Belongs to the sterol desaturase family. TMEM195 subfamily.
Protein type: Membrane protein, integral; Membrane protein, multi-pass; EC 1.14.16.5; Endoplasmic reticulum; Oxidoreductase
Cellular Component: endoplasmic reticulum membrane; endoplasmic reticulum; integral to membrane
Molecular Function: iron ion binding; glyceryl-ether monooxygenase activity
Biological Process: ether lipid metabolic process; membrane lipid metabolic process; fatty acid biosynthetic process
Similar Products
Product Notes
The TMEM195 agmo (Catalog #AAA5302339) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's TMEM195 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1 ug/ml. Researchers should empirically determine the suitability of the TMEM195 agmo for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "TMEM195, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
