Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: ANO1Sample Tissue: Human Hela Whole CellAntibody Dilution: 1ug/ml)

Rabbit TMEM16A Polyclonal Antibody | anti-ANO1 antibody

TMEM16A antibody - middle region

Gene Names
ANO1; DOG1; TAOS2; ORAOV2; TMEM16A
Reactivity
Tested Reactivity: Human
Predicted Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
Applications
Western Blot
Purity
Affinity Purified
Synonyms
TMEM16A; Polyclonal Antibody; TMEM16A antibody - middle region; anti-ANO1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Tested Reactivity: Human
Predicted Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml (varies by lot)
Sequence
HGFVNHTLSSFNVSDFQNGTAPNDPLDLGYEVQICRYKDYREPPWSENKY
Applicable Applications for anti-ANO1 antibody
Western Blot (WB)
Protein Size (# AA)
960 amino acids
Protein Interactions
UBC;
Blocking Peptide
For anti-ANO1 (MBS3206417) antibody is Catalog # MBS3231382
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human TMEM16A
Replacement Item
This antibody may replace item sc-135235 from Santa Cruz Biotechnology.
Predicted Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 79%; Rat: 100%
Preparation and Storage
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: ANO1Sample Tissue: Human Hela Whole CellAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: ANO1Sample Tissue: Human Hela Whole CellAntibody Dilution: 1ug/ml)

Western Blot (WB)

(Host: RabbitTarget Name: ANO1Sample Tissue: Human MCF7 Whole CellAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: ANO1Sample Tissue: Human MCF7 Whole CellAntibody Dilution: 1ug/ml)

Western Blot (WB)

(Host: RabbitTarget Name: ANO1Sample Type: Human LiverAntibody Dilution: 0.2 ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: ANO1Sample Type: Human LiverAntibody Dilution: 0.2 ug/ml)

Western Blot (WB)

(Host: RabbitTarget Name: TMEM16ASample Tissue: Human Fetal LiverAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: TMEM16ASample Tissue: Human Fetal LiverAntibody Dilution: 1.0ug/ml)

Western Blot (WB)

(Host: RabbitTarget Name: TMEM16ASample Type: Human Fetal MuscleLane A: Primary AntibodyLane B: Primary Antibody + Blocking PeptidePrimary Antibody Concentration: 1ug/mlPeptide Concentration: 5ug/mlLysate Quantity: 25ug/lane/laneGel Concentration: 0.12)

Western Blot (WB) (Host: RabbitTarget Name: TMEM16ASample Type: Human Fetal MuscleLane A: Primary AntibodyLane B: Primary Antibody + Blocking PeptidePrimary Antibody Concentration: 1ug/mlPeptide Concentration: 5ug/mlLysate Quantity: 25ug/lane/laneGel Concentration: 0.12)

Western Blot (WB)

(WB Suggested Anti-TMEM16A Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Human Muscle)

Western Blot (WB) (WB Suggested Anti-TMEM16A Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Human Muscle)
Related Product Information for anti-ANO1 antibody
TMEM16A belongs to the anoctamin family. TMEM16A acts as a calcium-activated chloride channel. It is required for normal tracheal development.
Product Categories/Family for anti-ANO1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
111kDa
NCBI Official Full Name
anoctamin-1
NCBI Official Synonym Full Names
anoctamin 1
NCBI Official Symbol
ANO1
NCBI Official Synonym Symbols
DOG1; TAOS2; ORAOV2; TMEM16A
NCBI Protein Information
anoctamin-1
UniProt Protein Name
Anoctamin-1
Protein Family
UniProt Gene Name
ANO1
UniProt Synonym Gene Names
DOG1; ORAOV2; TAOS2; TMEM16A
UniProt Entry Name
ANO1_HUMAN

Uniprot Description

ANO1: Acts as a calcium-activated chloride channel. Required for normal tracheal development. Belongs to the anoctamin family. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Transporter; Membrane protein, integral; Transporter, ion channel; Membrane protein, multi-pass

Chromosomal Location of Human Ortholog: 11q13.3

Cellular Component: apical plasma membrane; cytoplasm; plasma membrane; external side of plasma membrane

Molecular Function: protein binding; protein homodimerization activity; intracellular calcium activated chloride channel activity; protein heterodimerization activity; calcium activated cation channel activity

Biological Process: regulation of membrane potential; multicellular organismal development; chloride transport; transmembrane transport; cation transport

Research Articles on ANO1

Similar Products

Product Notes

The ANO1 ano1 (Catalog #AAA3206417) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TMEM16A antibody - middle region reacts with Tested Reactivity: Human Predicted Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit and may cross-react with other species as described in the data sheet. AAA Biotech's TMEM16A can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the ANO1 ano1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: HGFVNHTLSS FNVSDFQNGT APNDPLDLGY EVQICRYKDY REPPWSENKY. It is sometimes possible for the material contained within the vial of "TMEM16A, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.