Western Blot (WB)
(WB Suggested Anti-TMEM166 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: 293T cell lysate)
Rabbit TMEM166 Polyclonal Antibody | anti-EVA1A antibody
TMEM166 antibody - middle region
Gene Names
EVA1A; FAM176A; TMEM166
Reactivity
Dog, Horse, Human, Pig, Rabbit
Applications
Western Blot
Purity
Affinity Purified
Synonyms
TMEM166; Polyclonal Antibody; TMEM166 antibody - middle region; anti-EVA1A antibody
Host
Rabbit
Reactivity
Dog, Horse, Human, Pig, Rabbit
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: AALVIRISCHTDCRRRPGKKFLQDRESSSDSSDSEDGSEDTVSDLSVRRH
Sequence Length
152
Applicable Applications for anti-EVA1A antibody
Western Blot (WB)
Homology
Dog: 86%; Horse: 79%; Human: 100%; Pig: 79%; Rabbit: 79%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human TMEM166
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-TMEM166 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: 293T cell lysate)
Western Blot (WB)
(WB Suggested Anti-TMEM166 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: 293T cell lysate)
Related Product Information for anti-EVA1A antibody
This is a rabbit polyclonal antibody against TMEM166. It was validated on Western Blot
Target Description: TMEM166 belongs to the FAM176 family. It acts as a regulator of programmed cell death, mediating both autophagy and apoptosis.
Target Description: TMEM166 belongs to the FAM176 family. It acts as a regulator of programmed cell death, mediating both autophagy and apoptosis.
Product Categories/Family for anti-EVA1A antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
17kDa
NCBI Official Full Name
protein eva-1 homolog A
NCBI Official Synonym Full Names
eva-1 homolog A, regulator of programmed cell death
NCBI Official Symbol
EVA1A
NCBI Official Synonym Symbols
FAM176A; TMEM166
NCBI Protein Information
protein eva-1 homolog A
UniProt Protein Name
Protein eva-1 homolog A
Protein Family
UniProt Gene Name
EVA1A
UniProt Synonym Gene Names
FAM176A; TMEM166; SP24
UniProt Entry Name
EVA1A_HUMAN
Research Articles on EVA1A
Similar Products
Product Notes
The EVA1A eva1a (Catalog #AAA3214132) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TMEM166 antibody - middle region reacts with Dog, Horse, Human, Pig, Rabbit and may cross-react with other species as described in the data sheet. AAA Biotech's TMEM166 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the EVA1A eva1a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: AALVIRISCH TDCRRRPGKK FLQDRESSSD SSDSEDGSED TVSDLSVRRH. It is sometimes possible for the material contained within the vial of "TMEM166, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
