Western Blot (WB)
(Western Blot analysis of TMEM134 expression in transfected 293T cell line by TMEM134 polyclonal antibody. Lane 1: TMEM134 transfected lysate (21.6kD). Lane 2: Non-transfected lysate.)
Rabbit anti-Human TMEM134 Polyclonal Antibody | anti-TMEM134 antibody
TMEM134 (Transmembrane Protein 134)
Reactivity
Human
Applications
Western Blot
Purity
Affinity PurifiedPurified by Protein A affinity chromatography.
Synonyms
TMEM134; Polyclonal Antibody; TMEM134 (Transmembrane Protein 134); Anti -TMEM134 (Transmembrane Protein 134); anti-TMEM134 antibody
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human TMEM134.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
MSAARPQFSIDDAFELSLEDGGPGPESSGVARFGPLHFERRARFEVADEDKQSRLRYQNLENDEDGAQASPEPDGGVGTRDSSRTSIRSSQWSFSTISSSTQRSYNTCCSWTQHPLIQKNRRVVLASFLLLLLGLVLILVGVGLEATPSPGVSSAIFFVPGFLLLVPGVYHVIFIYCAVKGHRGFQFFYLPYFEK
Applicable Applications for anti-TMEM134 antibody
Western Blot (WB)
Application Notes
Suitable for use in Western Blot.
Immunogen
Full length human TMEM134, aa1-195 (NP_079400.1).
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Western Blot (WB)
(Western Blot analysis of TMEM134 expression in transfected 293T cell line by TMEM134 polyclonal antibody. Lane 1: TMEM134 transfected lysate (21.6kD). Lane 2: Non-transfected lysate.)
Western Blot (WB)
(Western Blot analysis of TMEM134 expression in transfected 293T cell line by TMEM134 polyclonal antibody. Lane 1: TMEM134 transfected lysate (21.6kD). Lane 2: Non-transfected lysate.)
Product Categories/Family for anti-TMEM134 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
21,586 Da
NCBI Official Full Name
transmembrane protein 134 isoform b
NCBI Official Synonym Full Names
transmembrane protein 134
NCBI Official Symbol
TMEM134
NCBI Protein Information
transmembrane protein 134
UniProt Protein Name
Transmembrane protein 134
Protein Family
UniProt Gene Name
TMEM134
UniProt Entry Name
TM134_HUMAN
Uniprot Description
Subcellular location: Membrane; Multi-pass membrane protein
Potential.
Sequence similarities: Belongs to the TMEM134/TMEM230 family.
Research Articles on TMEM134
Similar Products
Product Notes
The TMEM134 tmem134 (Catalog #AAA648373) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TMEM134 (Transmembrane Protein 134) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's TMEM134 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Suitable for use in Western Blot. Researchers should empirically determine the suitability of the TMEM134 tmem134 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MSAARPQFSI DDAFELSLED GGPGPESSGV ARFGPLHFER RARFEVADED KQSRLRYQNL ENDEDGAQAS PEPDGGVGTR DSSRTSIRSS QWSFSTISSS TQRSYNTCCS WTQHPLIQKN RRVVLASFLL LLLGLVLILV GVGLEATPSP GVSSAIFFVP GFLLLVPGVY HVIFIYCAVK GHRGFQFFYL PYFEK. It is sometimes possible for the material contained within the vial of "TMEM134, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
