Highly validated and characterized monoclonal/polyclonal
antibodies and recombinant
proteins
The majority of AAA Biotech’s antibodies are highly validated and can be use in multiple
applications such as ELISA, FC,
ICC, IF, IHC, IP, WB, etc. We have antibodies available for rare species, in multiple conjugated
forms or recombinant
antibodies.
As for our high quality proteins, the majority have 90% purity, detected by SDS-PAGE while some are
available in
different tags such as Flag, GST, His, MBP, etc. We also carry high quality native and biologically
active proteins.
AAA Biotech is constantly working to expand our capacity to provide recombinant proteins and
antibodies to most
target proteins.
SELECT `p`.*, `pd`.*, IFNULL(pdns.ncbi_summary, "N/A") as ncbi_summary_pdns, IFNULL(pdns.sp_comments, "N/A") as sp_comments_pdns, IFNULL(pdns.ncbi_research_articles, "N/A") as ncbi_research_articles_pdns, IFNULL(pe.products_description_extra, "N/A") as products_description_extra
FROM (`products`, `products` as `p`)
LEFT OUTER JOIN `products_description` as `pd` ON `p`.`products_id` = `pd`.`products_id`
LEFT OUTER JOIN `products_description_ncbi_sp` as `pdns` ON `p`.`products_id` = `pdns`.`products_id`
LEFT OUTER JOIN `products_extra` as `pe` ON `p`.`products_id` = `pe`.`products_id`
WHERE `p`.`products_id` = '19369'
AND `pd`.`language_id` = 1
LIMIT 1
Query
Database
11.83 ms
select p.*, pd.*,
ifnull(pdns.ncbi_summary, 'N/A') as ncbi_summary_pdns,
ifnull(pdns.sp_comments, 'N/A') as sp_comments_pdns,
ifnull(pdns.ncbi_research_articles, 'N/A') as ncbi_research_articles_pdns,
ifnull(pe.products_description_extra, 'N/A') as products_description_extra
from products p
LEFT OUTER JOIN products_description pd on p.products_id = pd.products_id
LEFT OUTER JOIN products_description_ncbi_sp pdns on p.products_id = pdns.products_id
LEFT OUTER JOIN products_extra pe on p.products_id = pe.products_id
where p.products_id = '19369' and pd.language_id = 1
Query
Database
1.41 ms
SELECT `options_values_price` as `price`, `products_options_values_name` as `package`
FROM `products_attributes`
JOIN `products_options_values` ON `products_options_values`.`products_options_values_id` = `products_attributes`.`options_values_id`
WHERE `products_attributes`.`products_id` = '19369'
Database (4 total Queries, 4 of them unique across 2 Connections)
Time
Query String
3.1 ms
SELECT `p`.*, `pd`.*, IFNULL(pdns.ncbi_summary, "N/A") as ncbi_summary_pdns, IFNULL(pdns.sp_comments, "N/A") as sp_comments_pdns, IFNULL(pdns.ncbi_research_articles, "N/A") as ncbi_research_articles_pdns, IFNULL(pe.products_description_extra, "N/A") as products_description_extra
FROM (`products`, `products` as `p`)
LEFT OUTER JOIN `products_description` as `pd` ON `p`.`products_id` = `pd`.`products_id`
LEFT OUTER JOIN `products_description_ncbi_sp` as `pdns` ON `p`.`products_id` = `pdns`.`products_id`
LEFT OUTER JOIN `products_extra` as `pe` ON `p`.`products_id` = `pe`.`products_id`
WHERE `p`.`products_id` = '19369'
AND `pd`.`language_id` = 1
LIMIT 1
select p.*, pd.*,
ifnull(pdns.ncbi_summary, 'N/A') as ncbi_summary_pdns,
ifnull(pdns.sp_comments, 'N/A') as sp_comments_pdns,
ifnull(pdns.ncbi_research_articles, 'N/A') as ncbi_research_articles_pdns,
ifnull(pe.products_description_extra, 'N/A') as products_description_extra
from products p
LEFT OUTER JOIN products_description pd on p.products_id = pd.products_id
LEFT OUTER JOIN products_description_ncbi_sp pdns on p.products_id = pdns.products_id
LEFT OUTER JOIN products_extra pe on p.products_id = pe.products_id
where p.products_id = '19369' and pd.language_id = 1
SELECT `options_values_price` as `price`, `products_options_values_name` as `package`
FROM `products_attributes`
JOIN `products_options_values` ON `products_options_values`.`products_options_values_id` = `products_attributes`.`options_values_id`
WHERE `products_attributes`.`products_id` = '19369'
⇄form => string (76) "Lyophilized. Each vial contains 4mg Trehalose, 0.9mg NaCl and 0.2mg Na2HPO4."
$value['form']
⇄concentration => string (3) "N/A"
$value['concentration']
⇄⧉storage_stability => string (202) "Store at -20 degree C for one year. After reconstitution, at 4 degree C for ...
$value['storage_stability']
Store at -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquotted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.
⇄⧉app_tested => string (138) "Western Blot (WB), Immunohistochemistry-Paraffin (IHC-P), Immunocytochemistr...
$value['app_tested']
Western Blot (WB), Immunohistochemistry-Paraffin (IHC-P), Immunocytochemistry (ICC), Immunofluorescence (IF), Flow Cytometry (FC/FACS/FCM)
⇄⧉testing_protocols => string (6132) "FCM (Flow Cytometry)||Figure 8. Flow Cytometry analysis of SiHa cells using ...
$value['testing_protocols']
FCM (Flow Cytometry)||Figure 8. Flow Cytometry analysis of SiHa cells using anti- ASS1 antibody (AAA19369).<br>Overlay histogram showing SiHa cells stained with AAA19369 (Blue line). The cells were blocked with 10% normal goat serum. And then incubated with mouse anti-ASS1 Antibody (AAA19369, 1μg/1x10<sup>6</sup> cells) for 30 min at 20 degree C. DyLight®488 conjugated goat anti-mouse IgG (BA1126, 5-10μg/1x10<sup>6</sup> cells) was used as secondary antibody for 30 minutes at 20 degree C. Isotype control antibody (Green line) was mouse IgG (1μg/1x10<sup>6</sup>) used under the same conditions. Unlabelled sample (Red line) was also used as a control.||AAA19369_FCM8.png!!IF (Immunofluorescence)||Figure 7. IF analysis of ASS1 using anti- ASS1 antibody (AAA19369).<br>ASS1 was detected in immunocytochemical section of MCF-7 cells. Enzyme antigen retrieval was performed using IHC enzyme antigen retrieval reagent for 15 mins. The cells were blocked with 10% goat serum. And then incubated with 5μg/mL mouse anti- ASS1 Antibody (AAA19369) overnight at 4 degree C. DyLight®488 Conjugated Goat Anti-Mouse IgG (BA1126) was used as secondary antibody at 1:100 dilution and incubated for 30 minutes at 37 degree C. The section was counterstained with DAPI. Visualize using a fluorescence microscope and filter sets appropriate for the label used.||AAA19369_IF7.jpg!!IHC (Immunohistchemistry)||Figure 6. IHC analysis of ASS1 using anti-ASS1 antibody (AAA19369).<br>ASS1 was detected in paraffin-embedded section of mouse kidney tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH8. 0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2μg/ml mouse anti-ASS1 Antibody (AAA19369) overnight at 4 degree C. Biotinylated goat anti-mouse IgG was used as secondary antibody and incubated for 30 minutes at 37 degree C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) (Catalog # with DAB as the chromogen.||AAA19369_IHC6.jpg!!IHC (Immunohistochemistry)||Figure 5. IHC analysis of ASS1 using anti-ASS1 antibody (AAA19369).<br>ASS1 was detected in paraffin-embedded section of rat liver tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH8. 0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2μg/ml mouse anti-ASS1 Antibody (AAA19369) overnight at 4 degree C. Biotinylated goat anti-mouse IgG was used as secondary antibody and incubated for 30 minutes at 37 degree C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) (Catalog # with DAB as the chromogen.||AAA19369_IHC5.jpg!!IHC (Immunohistochemistry)||Figure 4. IHC analysis of ASS1 using anti-ASS1 antibody (AAA19369).<br>ASS1 was detected in paraffin-embedded section of human colon cancer tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH8. 0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2μg/ml mouse anti-ASS1 Antibody (AAA19369) overnight at 4 degree C. Biotinylated goat anti-mouse IgG was used as secondary antibody and incubated for 30 minutes at 37 degree C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) (Catalog # with DAB as the chromogen.||AAA19369_IHC4.jpg!!IHC (Immunohistochemistry)||Figure 3. IHC analysis of ASS1 using anti-ASS1 antibody (AAA19369).<br>ASS1 was detected in paraffin-embedded section of human breast cancer tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH8. 0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2μg/ml mouse anti-ASS1 Antibody (AAA19369) overnight at 4 degree C. Biotinylated goat anti-mouse IgG was used as secondary antibody and incubated for 30 minutes at 37 degree C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) (Catalog # with DAB as the chromogen.||AAA19369_IHC3.jpg!!IHC (Immunohistochemistry)||Figure 2. IHC analysis of ASS1 using anti-ASS1 antibody (AAA19369).<br>ASS1 was detected in paraffin-embedded section of human prostate cancer tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH8. 0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2μg/ml mouse anti-ASS1 Antibody (AAA19369) overnight at 4 degree C. Biotinylated goat anti-mouse IgG was used as secondary antibody and incubated for 30 minutes at 37 degree C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) (Catalog # with DAB as the chromogen.||AAA19369_IHC2.jpg!!WB (Western Blot)||Figure 1. Western blot analysis of ASS1 using anti-ASS1 antibody (AAA19369).<br>Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions.<br>Lane 1: human Hela whole cell lysates<br>Lane 2: human HEPG2 whole cell lysates<br>Lane 3: human Hek293 wohle cell lysates<br>Lane 4: monkey kidney tissue lysates<br>Lane 5: rat liver tissue lysates<br>Lane 6: rat kidney tissue lysates<br>Lane 7: mouse liver tissue lysates<br>Lane 8: mouse kidney tissue lysates.<br>After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/ TBS for 1. 5 hour at RT. The membrane was incubated with mouse anti-ASS1 antigen affinity purified monoclonal antibody (Catalog # AAA19369) at 0. 5 μg/mL overnight at 4 degree C, then washed with TBS-0. 1%Tween 3 times with 5 minutes each and probed with a goat anti-mouse IgG-HRP secondary antibody at a dilution of 1:10000 for 1. 5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit (Catalog # with Tanon 5200 system. A specific band was detected for ASS1 at approximately 47KD. The expected band size for ASS1 is at 47KD.||AAA19369_WB.jpg
⇄⧉etc_term1 => string (163) "Immunogen||E Coli-derived human ASS1 recombinant protein (Position: S3-S365)...
$value['etc_term1']
Immunogen||E Coli-derived human ASS1 recombinant protein (Position: S3-S365).!!Reconstitution||Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Recommended Detection Systems||Recommended Detection Systems||Lab recommends Enhanced Chemiluminescent Kit with anti-Mouse IgG for Western blot, and HRP Conjugated anti-Mouse IgG Super Vision Assay Kit for IHC(P) and ICC.
⇄⧉products_description => string (594) "Argininosuccinate synthetase is an enzyme that in humans is encoded by the A...
$value['products_description']
Argininosuccinate synthetase is an enzyme that in humans is encoded by the ASS1 gene. It is mapped to 9q34. 11. The protein encoded by this gene catalyzes the penultimate step of the arginine biosynthetic pathway. There are approximately 10 to 14 copies of this gene including the pseudogenes scattered across the human genome, among which the one located on chromosome 9 appears to be the only functional gene for argininosuccinate synthetase. Mutations in the chromosome 9 copy of this gene cause citrullinemia. Two transcript variants encoding the same protein have been found for this gene.
⇄⧉products_references => string (753) "1. Engel, K., Hohne, W., Haberle, J. Mutations and polymorphisms in the huma...
$value['products_references']
1. Engel, K., Hohne, W., Haberle, J. Mutations and polymorphisms in the human argininosuccinate synthetase (ASS1) gene. Hum. Mutat. 30: 300-307, 2009.<br>2. Rabinovich, S., Adler, L., Yizhak, K., Sarver, A., Silberman, A., Agron, S., Stettner, N., Sun, Q., Brandis, A., Helbling, D., Korman, S., Itzkovitz, S., Dimmock, D., Ulitsky, I., Nagamani, S. C. S., Ruppin, E., Erez, A. Diversion of aspartate in ASS1-deficient tumours fosters de novo pyrimidine synthesis. Nature 527: 379-383, 2015.<br>3. Sase, M., Kobayashi, K., Imamura, Y., Saheki, T., Nakano, K., Miura, S., Mori, M. Level of translatable messenger RNA coding for argininosuccinate synthetase in the liver of the patients with quantitative-type citrullinemia. Hum. Genet. 69: 130-134, 1985.
⇄⧉products_related_diseases => string (223) "Nervous System Diseases||24!!Citrullinemia||24!!Brain Diseases||23!!Cardiova...
$value['products_related_diseases']
Nervous System Diseases||24!!Citrullinemia||24!!Brain Diseases||23!!Cardiovascular Diseases||13!!Heart Diseases||10!!Heart Failure||5!!Liver Diseases||4!!Carcinoma, Hepatocellular||4!!Inflammation||3!!Neoplasm Metastasis||3
⇄⧉ncbi_pathways => string (469) "Alanine And Aspartate Metabolism Pathway||198783!!Alanine, Aspartate And Glu...
$value['ncbi_pathways']
Alanine And Aspartate Metabolism Pathway||198783!!Alanine, Aspartate And Glutamate Metabolism Pathway||101142!!Alanine, Aspartate And Glutamate Metabolism Pathway||100063!!Arginine And Proline Metabolism Pathway||82957!!Arginine And Proline Metabolism Pathway||323!!Biosynthesis Of Amino Acids Pathway||790012!!Biosynthesis Of Amino Acids Pathway||795174!!Metabolic Pathways||132956!!Metabolism Pathway||477135!!Metabolism Of Amino Acids And Derivatives Pathway||106169
⇄form => string (76) "Lyophilized. Each vial contains 4mg Trehalose, 0.9mg NaCl and 0.2mg Na2HPO4."
$value->a['form']
⇄concentration => string (3) "N/A"
$value->a['concentration']
⇄⧉storage_stability => string (202) "Store at -20 degree C for one year. After reconstitution, at 4 degree C for ...
$value->a['storage_stability']
Store at -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquotted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.
⇄⧉app_tested => string (138) "Western Blot (WB), Immunohistochemistry-Paraffin (IHC-P), Immunocytochemistr...
$value->a['app_tested']
Western Blot (WB), Immunohistochemistry-Paraffin (IHC-P), Immunocytochemistry (ICC), Immunofluorescence (IF), Flow Cytometry (FC/FACS/FCM)
⇄⧉testing_protocols => string (6132) "FCM (Flow Cytometry)||Figure 8. Flow Cytometry analysis of SiHa cells using ...
$value->a['testing_protocols']
FCM (Flow Cytometry)||Figure 8. Flow Cytometry analysis of SiHa cells using anti- ASS1 antibody (AAA19369).<br>Overlay histogram showing SiHa cells stained with AAA19369 (Blue line). The cells were blocked with 10% normal goat serum. And then incubated with mouse anti-ASS1 Antibody (AAA19369, 1μg/1x10<sup>6</sup> cells) for 30 min at 20 degree C. DyLight®488 conjugated goat anti-mouse IgG (BA1126, 5-10μg/1x10<sup>6</sup> cells) was used as secondary antibody for 30 minutes at 20 degree C. Isotype control antibody (Green line) was mouse IgG (1μg/1x10<sup>6</sup>) used under the same conditions. Unlabelled sample (Red line) was also used as a control.||AAA19369_FCM8.png!!IF (Immunofluorescence)||Figure 7. IF analysis of ASS1 using anti- ASS1 antibody (AAA19369).<br>ASS1 was detected in immunocytochemical section of MCF-7 cells. Enzyme antigen retrieval was performed using IHC enzyme antigen retrieval reagent for 15 mins. The cells were blocked with 10% goat serum. And then incubated with 5μg/mL mouse anti- ASS1 Antibody (AAA19369) overnight at 4 degree C. DyLight®488 Conjugated Goat Anti-Mouse IgG (BA1126) was used as secondary antibody at 1:100 dilution and incubated for 30 minutes at 37 degree C. The section was counterstained with DAPI. Visualize using a fluorescence microscope and filter sets appropriate for the label used.||AAA19369_IF7.jpg!!IHC (Immunohistchemistry)||Figure 6. IHC analysis of ASS1 using anti-ASS1 antibody (AAA19369).<br>ASS1 was detected in paraffin-embedded section of mouse kidney tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH8. 0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2μg/ml mouse anti-ASS1 Antibody (AAA19369) overnight at 4 degree C. Biotinylated goat anti-mouse IgG was used as secondary antibody and incubated for 30 minutes at 37 degree C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) (Catalog # with DAB as the chromogen.||AAA19369_IHC6.jpg!!IHC (Immunohistochemistry)||Figure 5. IHC analysis of ASS1 using anti-ASS1 antibody (AAA19369).<br>ASS1 was detected in paraffin-embedded section of rat liver tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH8. 0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2μg/ml mouse anti-ASS1 Antibody (AAA19369) overnight at 4 degree C. Biotinylated goat anti-mouse IgG was used as secondary antibody and incubated for 30 minutes at 37 degree C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) (Catalog # with DAB as the chromogen.||AAA19369_IHC5.jpg!!IHC (Immunohistochemistry)||Figure 4. IHC analysis of ASS1 using anti-ASS1 antibody (AAA19369).<br>ASS1 was detected in paraffin-embedded section of human colon cancer tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH8. 0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2μg/ml mouse anti-ASS1 Antibody (AAA19369) overnight at 4 degree C. Biotinylated goat anti-mouse IgG was used as secondary antibody and incubated for 30 minutes at 37 degree C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) (Catalog # with DAB as the chromogen.||AAA19369_IHC4.jpg!!IHC (Immunohistochemistry)||Figure 3. IHC analysis of ASS1 using anti-ASS1 antibody (AAA19369).<br>ASS1 was detected in paraffin-embedded section of human breast cancer tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH8. 0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2μg/ml mouse anti-ASS1 Antibody (AAA19369) overnight at 4 degree C. Biotinylated goat anti-mouse IgG was used as secondary antibody and incubated for 30 minutes at 37 degree C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) (Catalog # with DAB as the chromogen.||AAA19369_IHC3.jpg!!IHC (Immunohistochemistry)||Figure 2. IHC analysis of ASS1 using anti-ASS1 antibody (AAA19369).<br>ASS1 was detected in paraffin-embedded section of human prostate cancer tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH8. 0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2μg/ml mouse anti-ASS1 Antibody (AAA19369) overnight at 4 degree C. Biotinylated goat anti-mouse IgG was used as secondary antibody and incubated for 30 minutes at 37 degree C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) (Catalog # with DAB as the chromogen.||AAA19369_IHC2.jpg!!WB (Western Blot)||Figure 1. Western blot analysis of ASS1 using anti-ASS1 antibody (AAA19369).<br>Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions.<br>Lane 1: human Hela whole cell lysates<br>Lane 2: human HEPG2 whole cell lysates<br>Lane 3: human Hek293 wohle cell lysates<br>Lane 4: monkey kidney tissue lysates<br>Lane 5: rat liver tissue lysates<br>Lane 6: rat kidney tissue lysates<br>Lane 7: mouse liver tissue lysates<br>Lane 8: mouse kidney tissue lysates.<br>After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/ TBS for 1. 5 hour at RT. The membrane was incubated with mouse anti-ASS1 antigen affinity purified monoclonal antibody (Catalog # AAA19369) at 0. 5 μg/mL overnight at 4 degree C, then washed with TBS-0. 1%Tween 3 times with 5 minutes each and probed with a goat anti-mouse IgG-HRP secondary antibody at a dilution of 1:10000 for 1. 5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit (Catalog # with Tanon 5200 system. A specific band was detected for ASS1 at approximately 47KD. The expected band size for ASS1 is at 47KD.||AAA19369_WB.jpg
⇄⧉etc_term1 => string (163) "Immunogen||E Coli-derived human ASS1 recombinant protein (Position: S3-S365)...
$value->a['etc_term1']
Immunogen||E Coli-derived human ASS1 recombinant protein (Position: S3-S365).!!Reconstitution||Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Recommended Detection Systems||Recommended Detection Systems||Lab recommends Enhanced Chemiluminescent Kit with anti-Mouse IgG for Western blot, and HRP Conjugated anti-Mouse IgG Super Vision Assay Kit for IHC(P) and ICC.
⇄⧉products_description => string (594) "Argininosuccinate synthetase is an enzyme that in humans is encoded by the A...
$value->a['products_description']
Argininosuccinate synthetase is an enzyme that in humans is encoded by the ASS1 gene. It is mapped to 9q34. 11. The protein encoded by this gene catalyzes the penultimate step of the arginine biosynthetic pathway. There are approximately 10 to 14 copies of this gene including the pseudogenes scattered across the human genome, among which the one located on chromosome 9 appears to be the only functional gene for argininosuccinate synthetase. Mutations in the chromosome 9 copy of this gene cause citrullinemia. Two transcript variants encoding the same protein have been found for this gene.
⇄⧉products_references => string (753) "1. Engel, K., Hohne, W., Haberle, J. Mutations and polymorphisms in the huma...
$value->a['products_references']
1. Engel, K., Hohne, W., Haberle, J. Mutations and polymorphisms in the human argininosuccinate synthetase (ASS1) gene. Hum. Mutat. 30: 300-307, 2009.<br>2. Rabinovich, S., Adler, L., Yizhak, K., Sarver, A., Silberman, A., Agron, S., Stettner, N., Sun, Q., Brandis, A., Helbling, D., Korman, S., Itzkovitz, S., Dimmock, D., Ulitsky, I., Nagamani, S. C. S., Ruppin, E., Erez, A. Diversion of aspartate in ASS1-deficient tumours fosters de novo pyrimidine synthesis. Nature 527: 379-383, 2015.<br>3. Sase, M., Kobayashi, K., Imamura, Y., Saheki, T., Nakano, K., Miura, S., Mori, M. Level of translatable messenger RNA coding for argininosuccinate synthetase in the liver of the patients with quantitative-type citrullinemia. Hum. Genet. 69: 130-134, 1985.
⇄⧉products_related_diseases => string (223) "Nervous System Diseases||24!!Citrullinemia||24!!Brain Diseases||23!!Cardiova...
$value->a['products_related_diseases']
Nervous System Diseases||24!!Citrullinemia||24!!Brain Diseases||23!!Cardiovascular Diseases||13!!Heart Diseases||10!!Heart Failure||5!!Liver Diseases||4!!Carcinoma, Hepatocellular||4!!Inflammation||3!!Neoplasm Metastasis||3
⇄⧉ncbi_pathways => string (469) "Alanine And Aspartate Metabolism Pathway||198783!!Alanine, Aspartate And Glu...
$value->a['ncbi_pathways']
Alanine And Aspartate Metabolism Pathway||198783!!Alanine, Aspartate And Glutamate Metabolism Pathway||101142!!Alanine, Aspartate And Glutamate Metabolism Pathway||100063!!Arginine And Proline Metabolism Pathway||82957!!Arginine And Proline Metabolism Pathway||323!!Biosynthesis Of Amino Acids Pathway||790012!!Biosynthesis Of Amino Acids Pathway||795174!!Metabolic Pathways||132956!!Metabolism Pathway||477135!!Metabolism Of Amino Acids And Derivatives Pathway||106169
⇄form => string (76) "Lyophilized. Each vial contains 4mg Trehalose, 0.9mg NaCl and 0.2mg Na2HPO4."
$value->d['form']
⇄concentration => string (3) "N/A"
$value->d['concentration']
⇄⧉storage_stability => string (202) "Store at -20 degree C for one year. After reconstitution, at 4 degree C for ...
$value->d['storage_stability']
Store at -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquotted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.
⇄⧉app_tested => string (138) "Western Blot (WB), Immunohistochemistry-Paraffin (IHC-P), Immunocytochemistr...
$value->d['app_tested']
Western Blot (WB), Immunohistochemistry-Paraffin (IHC-P), Immunocytochemistry (ICC), Immunofluorescence (IF), Flow Cytometry (FC/FACS/FCM)
⇄⧉testing_protocols => string (6132) "FCM (Flow Cytometry)||Figure 8. Flow Cytometry analysis of SiHa cells using ...
$value->d['testing_protocols']
FCM (Flow Cytometry)||Figure 8. Flow Cytometry analysis of SiHa cells using anti- ASS1 antibody (AAA19369).<br>Overlay histogram showing SiHa cells stained with AAA19369 (Blue line). The cells were blocked with 10% normal goat serum. And then incubated with mouse anti-ASS1 Antibody (AAA19369, 1μg/1x10<sup>6</sup> cells) for 30 min at 20 degree C. DyLight®488 conjugated goat anti-mouse IgG (BA1126, 5-10μg/1x10<sup>6</sup> cells) was used as secondary antibody for 30 minutes at 20 degree C. Isotype control antibody (Green line) was mouse IgG (1μg/1x10<sup>6</sup>) used under the same conditions. Unlabelled sample (Red line) was also used as a control.||AAA19369_FCM8.png!!IF (Immunofluorescence)||Figure 7. IF analysis of ASS1 using anti- ASS1 antibody (AAA19369).<br>ASS1 was detected in immunocytochemical section of MCF-7 cells. Enzyme antigen retrieval was performed using IHC enzyme antigen retrieval reagent for 15 mins. The cells were blocked with 10% goat serum. And then incubated with 5μg/mL mouse anti- ASS1 Antibody (AAA19369) overnight at 4 degree C. DyLight®488 Conjugated Goat Anti-Mouse IgG (BA1126) was used as secondary antibody at 1:100 dilution and incubated for 30 minutes at 37 degree C. The section was counterstained with DAPI. Visualize using a fluorescence microscope and filter sets appropriate for the label used.||AAA19369_IF7.jpg!!IHC (Immunohistchemistry)||Figure 6. IHC analysis of ASS1 using anti-ASS1 antibody (AAA19369).<br>ASS1 was detected in paraffin-embedded section of mouse kidney tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH8. 0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2μg/ml mouse anti-ASS1 Antibody (AAA19369) overnight at 4 degree C. Biotinylated goat anti-mouse IgG was used as secondary antibody and incubated for 30 minutes at 37 degree C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) (Catalog # with DAB as the chromogen.||AAA19369_IHC6.jpg!!IHC (Immunohistochemistry)||Figure 5. IHC analysis of ASS1 using anti-ASS1 antibody (AAA19369).<br>ASS1 was detected in paraffin-embedded section of rat liver tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH8. 0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2μg/ml mouse anti-ASS1 Antibody (AAA19369) overnight at 4 degree C. Biotinylated goat anti-mouse IgG was used as secondary antibody and incubated for 30 minutes at 37 degree C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) (Catalog # with DAB as the chromogen.||AAA19369_IHC5.jpg!!IHC (Immunohistochemistry)||Figure 4. IHC analysis of ASS1 using anti-ASS1 antibody (AAA19369).<br>ASS1 was detected in paraffin-embedded section of human colon cancer tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH8. 0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2μg/ml mouse anti-ASS1 Antibody (AAA19369) overnight at 4 degree C. Biotinylated goat anti-mouse IgG was used as secondary antibody and incubated for 30 minutes at 37 degree C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) (Catalog # with DAB as the chromogen.||AAA19369_IHC4.jpg!!IHC (Immunohistochemistry)||Figure 3. IHC analysis of ASS1 using anti-ASS1 antibody (AAA19369).<br>ASS1 was detected in paraffin-embedded section of human breast cancer tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH8. 0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2μg/ml mouse anti-ASS1 Antibody (AAA19369) overnight at 4 degree C. Biotinylated goat anti-mouse IgG was used as secondary antibody and incubated for 30 minutes at 37 degree C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) (Catalog # with DAB as the chromogen.||AAA19369_IHC3.jpg!!IHC (Immunohistochemistry)||Figure 2. IHC analysis of ASS1 using anti-ASS1 antibody (AAA19369).<br>ASS1 was detected in paraffin-embedded section of human prostate cancer tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH8. 0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2μg/ml mouse anti-ASS1 Antibody (AAA19369) overnight at 4 degree C. Biotinylated goat anti-mouse IgG was used as secondary antibody and incubated for 30 minutes at 37 degree C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) (Catalog # with DAB as the chromogen.||AAA19369_IHC2.jpg!!WB (Western Blot)||Figure 1. Western blot analysis of ASS1 using anti-ASS1 antibody (AAA19369).<br>Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions.<br>Lane 1: human Hela whole cell lysates<br>Lane 2: human HEPG2 whole cell lysates<br>Lane 3: human Hek293 wohle cell lysates<br>Lane 4: monkey kidney tissue lysates<br>Lane 5: rat liver tissue lysates<br>Lane 6: rat kidney tissue lysates<br>Lane 7: mouse liver tissue lysates<br>Lane 8: mouse kidney tissue lysates.<br>After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/ TBS for 1. 5 hour at RT. The membrane was incubated with mouse anti-ASS1 antigen affinity purified monoclonal antibody (Catalog # AAA19369) at 0. 5 μg/mL overnight at 4 degree C, then washed with TBS-0. 1%Tween 3 times with 5 minutes each and probed with a goat anti-mouse IgG-HRP secondary antibody at a dilution of 1:10000 for 1. 5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit (Catalog # with Tanon 5200 system. A specific band was detected for ASS1 at approximately 47KD. The expected band size for ASS1 is at 47KD.||AAA19369_WB.jpg
⇄⧉etc_term1 => string (163) "Immunogen||E Coli-derived human ASS1 recombinant protein (Position: S3-S365)...
$value->d['etc_term1']
Immunogen||E Coli-derived human ASS1 recombinant protein (Position: S3-S365).!!Reconstitution||Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Recommended Detection Systems||Recommended Detection Systems||Lab recommends Enhanced Chemiluminescent Kit with anti-Mouse IgG for Western blot, and HRP Conjugated anti-Mouse IgG Super Vision Assay Kit for IHC(P) and ICC.
⇄⧉products_description => string (594) "Argininosuccinate synthetase is an enzyme that in humans is encoded by the A...
$value->d['products_description']
Argininosuccinate synthetase is an enzyme that in humans is encoded by the ASS1 gene. It is mapped to 9q34. 11. The protein encoded by this gene catalyzes the penultimate step of the arginine biosynthetic pathway. There are approximately 10 to 14 copies of this gene including the pseudogenes scattered across the human genome, among which the one located on chromosome 9 appears to be the only functional gene for argininosuccinate synthetase. Mutations in the chromosome 9 copy of this gene cause citrullinemia. Two transcript variants encoding the same protein have been found for this gene.
⇄⧉products_references => string (753) "1. Engel, K., Hohne, W., Haberle, J. Mutations and polymorphisms in the huma...
$value->d['products_references']
1. Engel, K., Hohne, W., Haberle, J. Mutations and polymorphisms in the human argininosuccinate synthetase (ASS1) gene. Hum. Mutat. 30: 300-307, 2009.<br>2. Rabinovich, S., Adler, L., Yizhak, K., Sarver, A., Silberman, A., Agron, S., Stettner, N., Sun, Q., Brandis, A., Helbling, D., Korman, S., Itzkovitz, S., Dimmock, D., Ulitsky, I., Nagamani, S. C. S., Ruppin, E., Erez, A. Diversion of aspartate in ASS1-deficient tumours fosters de novo pyrimidine synthesis. Nature 527: 379-383, 2015.<br>3. Sase, M., Kobayashi, K., Imamura, Y., Saheki, T., Nakano, K., Miura, S., Mori, M. Level of translatable messenger RNA coding for argininosuccinate synthetase in the liver of the patients with quantitative-type citrullinemia. Hum. Genet. 69: 130-134, 1985.
⇄⧉products_related_diseases => string (223) "Nervous System Diseases||24!!Citrullinemia||24!!Brain Diseases||23!!Cardiova...
$value->d['products_related_diseases']
Nervous System Diseases||24!!Citrullinemia||24!!Brain Diseases||23!!Cardiovascular Diseases||13!!Heart Diseases||10!!Heart Failure||5!!Liver Diseases||4!!Carcinoma, Hepatocellular||4!!Inflammation||3!!Neoplasm Metastasis||3
⇄⧉ncbi_pathways => string (469) "Alanine And Aspartate Metabolism Pathway||198783!!Alanine, Aspartate And Glu...
$value->d['ncbi_pathways']
Alanine And Aspartate Metabolism Pathway||198783!!Alanine, Aspartate And Glutamate Metabolism Pathway||101142!!Alanine, Aspartate And Glutamate Metabolism Pathway||100063!!Arginine And Proline Metabolism Pathway||82957!!Arginine And Proline Metabolism Pathway||323!!Biosynthesis Of Amino Acids Pathway||790012!!Biosynthesis Of Amino Acids Pathway||795174!!Metabolic Pathways||132956!!Metabolism Pathway||477135!!Metabolism Of Amino Acids And Derivatives Pathway||106169
⇄⧉testing_protocols => string (1246) "FCM (Flow Cytometry)||Flow cytometric analysis of Hela cells with AGR2 antib...
$value[0]['_source']['testing_protocols']
FCM (Flow Cytometry)||Flow cytometric analysis of Hela cells with AGR2 antibody at 1/50 dilution (red) compared with an unlabelled control (cells without incubation with primary antibody; black). Alexa Fluor 488-conjugated goat anti rabbit IgG was used as the secondary antibody.||AAA30160_FCM6.jpg!!ICC (Immunocytochemistry)||ICC staining AGR2 in NIH/3T3 cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.||AAA30160_ICC5.jpg!!ICC (Immunocytochemistry)||ICC staining AGR2 in MCF-7 cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.||AAA30160_ICC4.jpg!!ICC (Immunocytochemistry)||ICC staining AGR2 in Hela cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.||AAA30160_ICC3.jpg!!IHC (Immunohistochemistry)||Immunohistochemical analysis of paraffin-embedded human colon tissue using anti-AGR2 antibody. Counter stained with hematoxylin.||AAA30160_IHC2.jpg!!WB (Western Blot)||Western blot analysis of AGR2 on MCF-7 cells lysates using anti-AGR2 antibody at 1/1, 000 dilution.||AAA30160_WB.jpg
⇄⧉products_name_syn => string (799) "AG 2 antibody; AG 2 protein antibody; AG-2 antibody; AG2 antibody; AG2 prote...
$value[0]['_source']['products_name_syn']
AG 2 antibody; AG 2 protein antibody; AG-2 antibody; AG2 antibody; AG2 protein antibody; AGR 2 antibody; AGR2 antibody; AGR2_HUMAN antibody; Anterior gradient 2 homolog (Xenopus laevis) antibody; anterior gradient 2 homolog antibody; Anterior gradient 2; Xenopus; homolog of antibody; Anterior gradient homolog 2 antibody; Anterior gradient protein 2 homolog antibody; GOB 4 antibody; GOB4 antibody; HAG 2 antibody; hAG-2 antibody; hAG2 antibody; HAG2/R antibody; HPC 8 antibody; hPC8 antibody; PDIA17 antibody; Protein disulfide isomerase family A member 17 antibody; secreted cement gland homolog antibody; Secreted cement gland protein XAG 2 homolog antibody; Secreted cement gland protein XAG-2 homolog antibody; Secreted cement gland protein XAG2 homolog antibody; XAG 2 antibody; XAG2 antibody
⇄products_gene_name => string (4) "AGR2"
$value[0]['_source']['products_gene_name']
⇄products_gene_name_syn => string (3) "N/A"
$value[0]['_source']['products_gene_name_syn']
⇄⧉products_description => string (827) "AGR2 (Anterior Gradient Protein 2), also known as AG2, GOB-4 or HAG-2, is a ...
$value[0]['_source']['products_description']
AGR2 (Anterior Gradient Protein 2), also known as AG2, GOB-4 or HAG-2, is a member of the anterior gradient homolog family. It is the human ortholog of XAG-2, the secreted Xenopus laevis Anterior Gradient protein. In X. laevis, it is involved in cement gland differentiation and neural marker gene expression. AGR2 is a secretory protein encoded by two different AGR2 transcripts. It interacts with LYPD3 and alpha-dystroglycan (DAG-1). AGR2 is ubiquitously expressed with up-regulated expression in prostate cancer, breast cancer, lung cancer, renal carcinomas and endometrial carcinomas. AGR2 expression is positively correlated with that of the estrogen receptor (ER) and is negatively correlated with that of the epidermal growth factor receptor (EGFR). AGR2 may serve as a potential therapeutic marker for various cancers.
anterior gradient protein 2 homolog; AG-2; HPC8; anterior gradient homolog 2; secreted cement gland homolog; secreted cement gland protein XAG-2 homolog; protein disulfide isomerase family A, member 17
aaa30160 rabbit human monoclonal sn74 01 proa affinity purified 1*tbs ph7.4 1 bsa 40 glycerol preservative 0.05 sodium azide western blot wb immunocytochemistry icc immunohistochemistry ihc immunoprecipitation ip flow cytometry fc facs 1:1000 5000 1:50 1:200 1:100 1:500 analysis of agr2 on mcf 7 cells lysates using anti antibody at 000 dilution aaa30160_wb immunohistochemical paraffin embedded colon tissue counter stained with hematoxylin aaa30160_ihc2 staining in hela green the nuclear stain is dapi blue were fixed paraformaldehyde permeabilised 0.25 triton x100 pbs aaa30160_icc3 aaa30160_icc4 nih 3t3 aaa30160_icc5 cytometric 50 red compared an unlabelled control without incubation primary black alexa fluor 488 conjugated goat igg was used as secondary aaa30160_fc6 ag 2 protein ag2 agr agr2_human anterior gradient homolog xenopus laevis gob 4 gob4 hag hag2 r hpc 8 hpc8 pdia17 disulfide isomerase family a member 17 secreted cement gland xag xag2 19,979 da 5453541 np_006399.1 o95994 nm_006408.3 606358 total ab type recombinant immunogen conjugation unconjugated sn7401 ph7.41 bsa40 mcf7 at000 cytometric50 fluor488 member17
⇄⧉products_description => string (676) "Principle of the Assay: This experiment use double-sandwich elisa technique ...
$value[1]['_source']['products_description']
Principle of the Assay: This experiment use double-sandwich elisa technique and the ELISA Kit provided is typical. The pre-coated antibody is Human Slit2 monoclonal antibody and the detecting antibody is polyclonal antibody with biotin labeled. Samples and biotin labeling antibody are added into ELISA plate wells and washed out with PBS or TBS. Then Avidin-peroxidase conjugates are added to ELISA wells in order; Use TMB substrate for coloring after reactant thoroughly washed out by PBS or TBS. TMB turns into blue in peroxidase catalytic and finally turns into yellow under the action of acid. The color depth and the testing factors in samples are positively correlated.
⇄⧉search_terms => string (408) "aaa13152 human no cross reaction with other factors typical testing data sta...
$value[1]['_source']['search_terms']
aaa13152 human no cross reaction with other factors typical testing data standard curve for reference only aaa13152_sc elisa kit slit homolog 2 slit2 protein drosophila 169,887 da k7av78_pantr 410353075 jaa43141.1 samples serum plasma or cell culture supernatant assay type quantitative sandwich detection range 10 ng ml 0.156 sensitivity up to 0.05 intra precision <= 8 inter 12 homolog2 range10 <=8 inter12
⇄⧉specificity => string (183) "This assay has high sensitivity and excellent specificity for detection of h...
$value[2]['_source']['specificity']
This assay has high sensitivity and excellent specificity for detection of human Slit2. No significant cross-reactivity or interference between human Slit2 and analogues was observed.
⇄purity => string (3) "N/A"
$value[2]['_source']['purity']
⇄form => string (3) "N/A"
$value[2]['_source']['form']
⇄concentration => string (3) "N/A"
$value[2]['_source']['concentration']
⇄⧉storage_stability => string (129) "Unopened test kits should be stored at 2 to 8 degree C upon receipt. Please ...
$value[2]['_source']['storage_stability']
Unopened test kits should be stored at 2 to 8 degree C upon receipt. Please refer to pdf manual for further storage instructions.
⇄⧉etc_term2 => string (327) "Intra-assay Precision||Intra-assay Precision (Precision within an assay): CV...
$value[2]['_source']['etc_term2']
Intra-assay Precision||Intra-assay Precision (Precision within an assay): CV%<8%. Three samples of known concentration were tested twenty times on one plate to assess.!!Inter-assay Precision||Inter-assay Precision (Precision between assays): CV%<10%. Three samples of known concentration were tested in twenty assays to assess.
⇄⧉products_description => string (735) "Principle of the Assay: This assay employs the quantitative sandwich enzyme ...
$value[2]['_source']['products_description']
Principle of the Assay: This assay employs the quantitative sandwich enzyme immunoassay technique. Antibody specific for Slit2 has been pre-coated onto a microplate. Standards and samples are pipetted into the wells and any Slit2 present is bound by the immobilized antibody. After removing any unbound substances, a biotin-conjugated antibody specific for Slit2 is added to the wells. After washing, avidin conjugated Horseradish Peroxidase (HRP) is added to the wells. Following a wash to remove any unbound avidin-enzyme reagent, a substrate solution is added to the wells and color develops in proportion to the amount of Slit2 bound in the initial step. The color development is stopped and the intensity of the color is measured.
⇄products_references => string (3) "N/A"
$value[2]['_source']['products_references']
⇄⧉products_related_diseases => string (227) "Breast Neoplasms||23!!Nervous System Diseases||20!!Lung Neoplasms||16!!Skin ...
$value[2]['_source']['products_related_diseases']
Breast Neoplasms||23!!Nervous System Diseases||20!!Lung Neoplasms||16!!Skin Diseases||15!!Neoplasm Metastasis||13!!Brain Diseases||11!!Inflammation||10!!Liver Diseases||6!!Disease Models, Animal||6!!Small Cell Lung Carcinoma||6
⇄products_categories => string (3) "N/A"
$value[2]['_source']['products_categories']
⇄ncbi_full_name => string (32) "slit homolog 2 protein isoform 2"
Activation Of Rac Pathway||119530!!Axon Guidance Pathway||83065!!Axon Guidance Pathway||476!!Axon Guidance Pathway||105688!!Developmental Biology Pathway||477129!!Glypican 1 Network Pathway||138010!!Inactivation Of Cdc42 And Rac Pathway||119529!!Netrin-1 Signaling Pathway||160999!!Regulation Of Commissural Axon Pathfinding By Slit And Robo Pathway||119528!!Role Of Abl In Robo-Slit Signaling Pathway||119531
⇄⧉search_terms => string (532) "aaa15513 human this assay has high sensitivity and excellent specificity for...
$value[2]['_source']['search_terms']
aaa15513 human this assay has high sensitivity and excellent specificity for detection of slit2 no significant cross reactivity or interference between analogues was observed typical testing data standard curve reference only aaa15513_td elisa kit slit homolog 2 drosophila flj14420 slil3 protein isoform 169,870 da slit2_human 574281850 np_001276064.1 o94813 nm_001289135.1 o95710 q17ru3 q9y5q7 b7zlr5 603746 samples serum plasma tissue homogenates type sandwich range 0.78 ng ml 50 0.195 intra precision within an cv homolog2 ml50
<b>Storage:</b><br>Avoid repeated freeze/thaw cycles.<br>Store at 4 degree C for frequent use.<br>Aliquot and store at -20 degree C for 24 months.<br><br><b>Stability Test:</b><br>thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37 degree C for 48h, and no obvious degradation and precipitation were observed. The loss rate is less than 5% within the expiration date under appropriate storage condition.
Western blotting: 0.5-3ug/mL;<br>Immunohistochemistry: 5-30ug/mL;<br>Immunocytochemistry: 5-30ug/mL;<br>Optimal working dilutions must be determined by end user.
⇄⧉testing_protocols => string (1268) "IHC (Immunohistchemistry)||DAB staining on IHC-P;<br>Samples: Human Kidney T...
$value[3]['_source']['testing_protocols']
IHC (Immunohistchemistry)||DAB staining on IHC-P;<br>Samples: Human Kidney Tissue;<br>Primary Ab: 30ug/ml Rabbit Anti-Human MIB2 Antibody<br>Second Ab: 2ug/mL HRP-Linked Caprine Anti-Rabbit IgG Polyclonal Antibody||AAA20152_IHC6.png!!IHC (Immunohistochemistry)||DAB staining on IHC-P;<br>Samples: Human Lung cancer Tissue;<br>Primary Ab: 30ug/ml Rabbit Anti-Human MIB2 Antibody<br>Second Ab: 2ug/mL HRP-Linked Caprine Anti-Rabbit IgG Polyclonal Antibody||AAA20152_IHC5.png!!IHC (Immunohistochemistry)||DAB staining on IHC-P;<br>Samples: Human Liver cancer Tissue;<br>Primary Ab: 30ug/ml Rabbit Anti-Human MIB2 Antibody<br>Second Ab: 2ug/mL HRP-Linked Caprine Anti-Rabbit IgG Polyclonal Antibody||AAA20152_IHC4.png!!IHC (Immunohistochemistry)||DAB staining on IHC-P;<br>Samples: Human Cerebrum Tissue;<br>Primary Ab: 30ug/ml Rabbit Anti-Human MIB2 Antibody<br>Second Ab: 2ug/mL HRP-Linked Caprine Anti-Rabbit IgG Polyclonal Antibody||AAA20152_IHC3.png!!IHC (Immunohistochemistry)||DAB staining on IHC-P;<br>Samples: Human Liver Tissue;<br>Primary Ab: 30ug/ml Rabbit Anti-Human MIB2 Antibody<br>Second Ab: 2ug/mL HRP-Linked Caprine Anti-Rabbit IgG Polyclonal Antibody||AAA20152_IHC2.jpg!!WB (Western Blot)||Western Blot: Sample: Recombinant MIB2, Human.||AAA20152_WB.jpg
⇄⧉ncbi_pathways => string (174) "Activated NOTCH1 Transmits Signal To The Nucleus Pathway||576270!!Signal Tra...
$value[3]['_source']['ncbi_pathways']
Activated NOTCH1 Transmits Signal To The Nucleus Pathway||576270!!Signal Transduction Pathway||477114!!Signaling By NOTCH Pathway||106485!!Signaling By NOTCH1 Pathway||576269
⇄⧉specificity => string (185) "This assay has high sensitivity and excellent specificity for detection of h...
$value[4]['_source']['specificity']
This assay has high sensitivity and excellent specificity for detection of human TXNDC5. No significant cross-reactivity or interference between human TXNDC5 and analogues was observed.
⇄purity => string (3) "N/A"
$value[4]['_source']['purity']
⇄form => string (3) "N/A"
$value[4]['_source']['form']
⇄concentration => string (3) "N/A"
$value[4]['_source']['concentration']
⇄⧉storage_stability => string (129) "Unopened test kits should be stored at 2 to 8 degree C upon receipt. Please ...
$value[4]['_source']['storage_stability']
Unopened test kits should be stored at 2 to 8 degree C upon receipt. Please refer to pdf manual for further storage instructions.
⇄⧉etc_term2 => string (327) "Intra-assay Precision||Intra-assay Precision (Precision within an assay): CV...
$value[4]['_source']['etc_term2']
Intra-assay Precision||Intra-assay Precision (Precision within an assay): CV%<8%. Three samples of known concentration were tested twenty times on one plate to assess.!!Inter-assay Precision||Inter-assay Precision (Precision between assays): CV%<10%. Three samples of known concentration were tested in twenty assays to assess.
Human Thioredoxin domain-containing protein 5 (TXNDC5) ELISA kit; ERP46; EndoPDI; Hcc-2; MGC3178; PDIA15; UNQ364; endothelial protein disulphide isomerase; protein disulfide isomerase family A; member 15; thioredoxin domain containing 5; thioredoxin related protein; thioredoxin domain containing 5 (endoplasmic reticulum)
⇄products_gene_name => string (6) "TXNDC5"
$value[4]['_source']['products_gene_name']
⇄products_gene_name_syn => string (3) "N/A"
$value[4]['_source']['products_gene_name_syn']
⇄⧉products_description => string (739) "Principle of the Assay: This assay employs the quantitative sandwich enzyme ...
$value[4]['_source']['products_description']
Principle of the Assay: This assay employs the quantitative sandwich enzyme immunoassay technique. Antibody specific for TXNDC5 has been pre-coated onto a microplate. Standards and samples are pipetted into the wells and any TXNDC5 present is bound by the immobilized antibody. After removing any unbound substances, a biotin-conjugated antibody specific for TXNDC5 is added to the wells. After washing, avidin conjugated Horseradish Peroxidase (HRP) is added to the wells. Following a wash to remove any unbound avidin-enzyme reagent, a substrate solution is added to the wells and color develops in proportion to the amount of TXNDC5 bound in the initial step. The color development is stopped and the intensity of the color is measured.
⇄⧉ncbi_protein_info => string (284) "thioredoxin domain-containing protein 5; ER protein 46; thioredoxin related ...
$value[4]['_source']['ncbi_protein_info']
thioredoxin domain-containing protein 5; ER protein 46; thioredoxin related protein; thioredoxin-like protein p46; endoplasmic reticulum protein ERp46; endothelial protein disulphide isomerase; endoplasmic reticulum resident protein 46; protein disulfide isomerase family A, member 15
⇄sp_protein_name => string (39) "Thioredoxin domain-containing protein 5"
$value[4]['_source']['sp_protein_name']
⇄⧉sp_protein_name_syn => string (93) "Endoplasmic reticulum resident protein 46; ER protein 46; ERp46; Thioredoxin...
$value[4]['_source']['sp_protein_name_syn']
Endoplasmic reticulum resident protein 46; ER protein 46; ERp46; Thioredoxin-like protein p46
⇄sp_gene_name => string (6) "TXNDC5"
$value[4]['_source']['sp_gene_name']
⇄sp_gene_name_syn => string (42) "TLP46; UNQ364/PRO700; ER protein 46; ERp46"
$value[4]['_source']['sp_gene_name_syn']
⇄sp_entry_name => string (11) "TXND5_HUMAN"
$value[4]['_source']['sp_entry_name']
⇄sp_mim => string (3) "N/A"
$value[4]['_source']['sp_mim']
⇄sp_interactions => string (3) "N/A"
$value[4]['_source']['sp_interactions']
⇄products_url => string (3) "N/A"
$value[4]['_source']['products_url']
⇄products_viewed => string (1) "0"
$value[4]['_source']['products_viewed']
⇄⧉search_terms => string (861) "aaa18364 human this assay has high sensitivity and excellent specificity for...
$value[4]['_source']['search_terms']
aaa18364 human this assay has high sensitivity and excellent specificity for detection of rat txb2 no significant cross reactivity or interference between analogues was observed typical testing data standard curve reference only aaa18364_td elisa kit thioredoxin domain containing 5 endoplasmic reticulum protein txndc5 erp46 endopdi hcc 2 mgc3178 pdia15 unq364 endothelial disulphide isomerase disulfide family a member 15 related isoform 3 strf8 er 46 like p46 resident 47,629 da tlp46 pro700 txnd5_human 224493972 np_001139021.1 q8nbs9 nm_001145549.2 q5tcq0 q8nd33 q8tct2 q9bvh9 b2rdm2 samples serum plasma tissue homogenates type quantitative sandwich range 3.9 pg ml 250 0.97 intra precision within an cv <8 three known concentration were tested twenty times on one plate to assess inter assays <10 in containing5 hcc2 member15 isoform3 er46 range3.9 ml250
⇄⧉specificity => string (183) "This assay has high sensitivity and excellent specificity for detection of h...
$value[5]['_source']['specificity']
This assay has high sensitivity and excellent specificity for detection of human PDIA3. No significant cross-reactivity or interference between human PDIA3 and analogues was observed.
⇄purity => string (3) "N/A"
$value[5]['_source']['purity']
⇄form => string (3) "N/A"
$value[5]['_source']['form']
⇄concentration => string (3) "N/A"
$value[5]['_source']['concentration']
⇄⧉storage_stability => string (129) "Unopened test kits should be stored at 2 to 8 degree C upon receipt. Please ...
$value[5]['_source']['storage_stability']
Unopened test kits should be stored at 2 to 8 degree C upon receipt. Please refer to pdf manual for further storage instructions.
⇄⧉etc_term2 => string (327) "Intra-assay Precision||Intra-assay Precision (Precision within an assay): CV...
$value[5]['_source']['etc_term2']
Intra-assay Precision||Intra-assay Precision (Precision within an assay): CV%<8%. Three samples of known concentration were tested twenty times on one plate to assess.!!Inter-assay Precision||Inter-assay Precision (Precision between assays): CV%<10%. Three samples of known concentration were tested in twenty assays to assess.
⇄products_price => string (6) "0.0000"
$value[5]['_source']['products_price']
⇄products_weight => string (4) "5.00"
$value[5]['_source']['products_weight']
⇄products_status => boolean true
$value[5]['_source']['products_status']
⇄products_tax_class_id => string (1) "1"
$value[5]['_source']['products_tax_class_id']
⇄manufacturers_id => string (3) "700"
$value[5]['_source']['manufacturers_id']
⇄products_ordered => string (1) "0"
$value[5]['_source']['products_ordered']
⇄language_id => string (1) "1"
$value[5]['_source']['language_id']
⇄products_name => string (46) "protein disulfide isomerase family A, member 3"
Human protein disulfide-isomerase A3; PDIA3 ELISA Kit; ER60; ERp57; ERp60; ERp61; GRP57; GRP58; HsT17083; P58; PI-PLC; 58 kDa microsomal protein; endoplasmic reticulum P58; glucose regulated protein; 58kDa; phospholipase C-alpha; protein disulfide isomerase; protein disulfide isomerase family A; member 3
⇄products_gene_name => string (5) "PDIA3"
$value[5]['_source']['products_gene_name']
⇄products_gene_name_syn => string (3) "N/A"
$value[5]['_source']['products_gene_name_syn']
⇄⧉products_description => string (735) "Principle of the Assay: This assay employs the quantitative sandwich enzyme ...
$value[5]['_source']['products_description']
Principle of the Assay: This assay employs the quantitative sandwich enzyme immunoassay technique. Antibody specific for PDIA3 has been pre-coated onto a microplate. Standards and samples are pipetted into the wells and any PDIA3 present is bound by the immobilized antibody. After removing any unbound substances, a biotin-conjugated antibody specific for PDIA3 is added to the wells. After washing, avidin conjugated Horseradish Peroxidase (HRP) is added to the wells. Following a wash to remove any unbound avidin-enzyme reagent, a substrate solution is added to the wells and color develops in proportion to the amount of PDIA3 bound in the initial step. The color development is stopped and the intensity of the color is measured.
⇄⧉ncbi_protein_info => string (448) "protein disulfide-isomerase A3; ER protein 57; ER protein 60; phospholipase ...
$value[5]['_source']['ncbi_protein_info']
protein disulfide-isomerase A3; ER protein 57; ER protein 60; phospholipase C-alpha; 58 kDa microsomal protein; disulfide isomerase ER-60; endoplasmic reticulum P58; 58 kDa glucose-regulated protein; glucose regulated protein, 58kDa; epididymis secretory protein Li 269; protein disulfide isomerase-associated 3; endoplasmic reticulum resident protein 57; endoplasmic reticulum resident protein 60; epididymis secretory sperm binding protein Li 93n
Adaptive Immune System Pathway||366160!!Antigen Presentation: Folding, Assembly And Peptide Loading Of Class I MHC Pathway||366163!!Antigen Processing And Presentation Pathway||83074!!Antigen Processing And Presentation Pathway||485!!Antigen Processing-Cross Presentation Pathway||477122!!Asparagine N-linked Glycosylation Pathway||161013!!Calnexin/calreticulin Cycle Pathway||187218!!Class I MHC Mediated Antigen Processing & Presentation Pathway||366161!!ER-Phagosome Pathway||477124!!Immune System Pathway||106386
58 kDa glucose-regulated protein; 58 kDa microsomal protein; p58; Disulfide isomerase ER-60; Endoplasmic reticulum resident protein 57; ER protein 57; ERp57; Endoplasmic reticulum resident protein 60; ER protein 60; ERp60
⇄sp_gene_name => string (5) "PDIA3"
$value[5]['_source']['sp_gene_name']
⇄sp_gene_name_syn => string (68) "ERP57; ERP60; GRP58; p58; ER protein 57; ERp57; ER protein 60; ERp60"
⇄⧉search_terms => string (781) "aaa15047 human this assay has high sensitivity and excellent specificity for...
$value[5]['_source']['search_terms']
aaa15047 human this assay has high sensitivity and excellent specificity for detection of pdia3 no significant cross reactivity or interference between analogues was observed typical testing data standard curve reference only aaa15047_td elisa kit protein disulfide isomerase family a member 3 a3 er60 erp57 erp60 erp61 grp57 grp58 hst17083 p58 pi plc 58 kda microsomal endoplasmic reticulum glucose regulated 58kda phospholipase c alpha hel s 269 93n er 57 60 epididymis secretory li associated resident sperm binding 56,782 da pdia3_human 21361657 np_005304.3 p30101 aab37397 nm_005313.4 q13453 q14255 q8iyf8 q9umu7 602046 samples serum plasma cell culture supernates type quantitative sandwich range 1.25 ng ml 80 < 0.31 intra precision within an cv member3 plc58 s269 er57 ml80
⇄⧉testing_protocols => string (1305) "ICC (Immunocytochemistry)||ICC staining ERp29 in SiHa cells (green). The nuc...
$value[6]['_source']['testing_protocols']
ICC (Immunocytochemistry)||ICC staining ERp29 in SiHa cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.||AAA30478_ICC7.jpg!!ICC (Immunocytochemistry)||ICC staining ERp29 in PMVEC cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.||AAA30478_ICC6.jpg!!ICC (Immunocytochemistry)||ICC staining ERp29 in F9 cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.||AAA30478_ICC5.jpg!!IHC (Immunohistochemistry)||Immunohistochemical analysis of paraffin-embedded human colon cancer tissue using anti-ERp29 antibody. Counter stained with hematoxylin.||AAA30478_IHC4.jpg!!IHC (Immunohistochemistry)||Immunohistochemical analysis of paraffin-embedded human thyroid gland tissue using anti-ERp29 antibody. Counter stained with hematoxylin.||AAA30478_IHC3.jpg!!IHC (Immunohistochemistry)||Immunohistochemical analysis of paraffin-embedded rat testis tissue using anti-ERp29 antibody. Counter stained with hematoxylin.||AAA30478_IHC2.jpg!!WB (Western Blot)||Western blot analysis of ERp29 on THP-1 cell using anti-ERp29 antibody at 1/500 dilution.||AAA30478_WB.jpg
⇄⧉etc_term1 => string (96) "Antibody Type||Recombinant Antibody!!Immunogen||Recombinant protein within h...
$value[6]['_source']['etc_term1']
Antibody Type||Recombinant Antibody!!Immunogen||Recombinant protein within human ERp29 aa 1-150.
C12orf8 antibody; Chromosome 12 open reading frame 8 antibody; Endoplasmic reticulum lumenal protein ERp28 antibody; Endoplasmic reticulum protein 29 antibody; Endoplasmic reticulum protein 29 isoform 1 antibody; Endoplasmic reticulum protein ERp29 antibody; Endoplasmic reticulum resident protein 28 antibody; Endoplasmic reticulum resident protein 29 antibody; Endoplasmic reticulum resident protein 31 antibody; Epididymis secretory protein Li 107 antibody; ERp28 antibody; ERP29_HUMAN antibody; ERp31 antibody; HEL S 107 antibody; PDI-DB antibody; PDIA9 antibody; Protein disulfide isomerase family A member 9 antibody
⇄products_gene_name => string (5) "ERp29"
$value[6]['_source']['products_gene_name']
⇄products_gene_name_syn => string (3) "N/A"
$value[6]['_source']['products_gene_name_syn']
⇄⧉products_description => string (521) "ERp29 is a reticuloplasmin, a protein which resides in the lumen of the endo...
$value[6]['_source']['products_description']
ERp29 is a reticuloplasmin, a protein which resides in the lumen of the endoplasmic reticulum (ER). The protein shows sequence similarity to the protein disulfide-isomerase family. However, it lacks the thioredoxin motif characteristic of this family, suggesting that this protein does not function as a disulfide isomerase. The protein dimerizes and is thought to play a role in the processing of secretory proteins within the ER. Alternative splicing results in multiple transcript variants encoding different isoforms.
endoplasmic reticulum resident protein 29; endoplasmic reticulum resident protein 28; endoplasmic reticulum resident protein 31; endoplasmic reticulum lumenal protein ERp28; protein disulfide isomerase family A, member 9
⇄⧉search_terms => string (1113) "aaa30478 rabbit human mouse rat monoclonal jg34 42 proa affinity purified 1*...
$value[6]['_source']['search_terms']
aaa30478 rabbit human mouse rat monoclonal jg34 42 proa affinity purified 1*tbs ph7.4 1 bsa 40 glycerol preservative 0.05 sodium azide western blot wb immunocytochemistry icc immunofluorescence if immunohistochemistry ihc 1:500 1:1000 1:50 1:200 analysis of erp29 on thp cell using anti antibody at 500 dilution aaa30478_wb immunohistochemical paraffin embedded testis tissue counter stained with hematoxylin aaa30478_ihc2 thyroid gland aaa30478_ihc3 colon cancer aaa30478_ihc4 staining in f9 cells green the nuclear stain is dapi blue were fixed paraformaldehyde permeabilised 0.25 triton x100 pbs aaa30478_icc5 pmvec aaa30478_icc6 siha aaa30478_icc7 c12orf8 chromosome 12 open reading frame 8 endoplasmic reticulum lumenal protein erp28 29 isoform resident 28 31 epididymis secretory li 107 erp29_human erp31 hel s pdi db pdia9 disulfide isomerase family a member 9 2 28,993 da 77628151 np_001029197.1 p30040 nm_001034025.1 q3mjc3 q6fht4 c9j183 602287 total ab type recombinant immunogen within aa 150 conjugation unconjugated jg3442 ph7.41 bsa40 at500 chromosome12 frame8 erp2829 resident28 li107 member9 aa150
Assay Type||Quantitative Sandwich!!Samples||Serum, plasma, cell culture supernates, Ascites, tissue homogenates or other biological fluids!!Detection Range||0.05-20ng/ml!!Sensitivity||0.021ng/ml
⇄⧉etc_term2 => string (403) "Intra-assay Precision||Intra-Assay Precision (Precision within an assay) Thr...
$value[7]['_source']['etc_term2']
Intra-assay Precision||Intra-Assay Precision (Precision within an assay) Three samples of known concentration were tested on one plate to assess intra-assay precision. Intra-Assay: CV<8%!!Inter-assay Precision||Inter-Assay Precision (Precision between assays) Three samples of known concentration were tested in separate assays to assess inter-assay precision. CV(%) = SD/mean x 100. Inter-Assay: CV<10%
⇄products_price => string (6) "0.0000"
$value[7]['_source']['products_price']
⇄products_weight => string (4) "5.00"
$value[7]['_source']['products_weight']
⇄products_status => boolean true
$value[7]['_source']['products_status']
⇄products_tax_class_id => string (1) "1"
$value[7]['_source']['products_tax_class_id']
⇄manufacturers_id => string (3) "160"
$value[7]['_source']['manufacturers_id']
⇄products_ordered => string (1) "0"
$value[7]['_source']['products_ordered']
⇄language_id => string (1) "1"
$value[7]['_source']['language_id']
⇄products_name => string (34) "Enhancer Of Zeste Homolog 2 (EZH2)"
⇄⧉products_description => string (894) "Principle of the Assay: This kit is an Enzyme-Linked Immunosorbent Assay (EL...
$value[7]['_source']['products_description']
Principle of the Assay: This kit is an Enzyme-Linked Immunosorbent Assay (ELISA). The plate has been pre-coated with Human EZH2 antibody. EZH2 present in the sample is added and binds to antibodies coated on the wells. And then biotinylated Human EZH2 Antibody is added and binds to EZH2 in the sample. Then Streptavidin-HRP is added and binds to the Biotinylated EZH2 antibody. After incubation unbound Streptavidin-HRP is washed away during a washing step. Substrate solution is then added and color develops in proportion to the amount of Human EZH2. The reaction is terminated by addition of acidic stop solution and absorbance is measured at 450 nm.<br><br>Intended Uses: This sandwich kit is for the accurate quantitative detection of Human Enhancer Of Zeste Homolog 2 (also known as EZH2) in serum, plasma, cell culture supernates, Ascites, tissue homogenates or other biological fluids.
⇄⧉search_terms => string (669) "aaa11215 human typical testing data standard curve for reference only aaa112...
$value[7]['_source']['search_terms']
aaa11215 human typical testing data standard curve for reference only aaa11215_sc elisa kit enhancer of zeste homolog 2 ezh2 polycomb repressive complex subunit wvs enx1 kmt6 wvs2 enx 1 ezh2b kmt6a histone lysine n methyltransferase 86,018 da 1575349 aac51520.1 q15910 q15755 q75mg3 q92857 q96fi6 b2raq1 b3ks30 b7z1d6 b7z7l6 samples serum plasma cell culture supernates ascites tissue homogenates or other biological fluids assay type quantitative sandwich detection range 0.05 20ng ml sensitivity 0.021ng intra precision within an three known concentration were tested on one plate to assess cv<8 inter between assays in separate cv = sd mean x 100 cv<10 homolog2 x100
⇄⧉specificity => string (227) "Human Protein Disulfide-isomerase A3 (PDIA3) ELISA Kit has high sensitivity ...
$value[8]['_source']['specificity']
Human Protein Disulfide-isomerase A3 (PDIA3) ELISA Kit has high sensitivity and excellent specificity for detection of Human PDIA3. No significant cross-reactivity or interference between Human PDIA3 and analogues was observed.
⇄purity => string (3) "N/A"
$value[8]['_source']['purity']
⇄form => string (3) "N/A"
$value[8]['_source']['form']
⇄concentration => string (3) "N/A"
$value[8]['_source']['concentration']
⇄storage_stability => string (22) "Store at 2-8 degree C."
Assay Type||Sandwich!!Samples||Human serum, cell culture supernates and other biological fluids!!Detection Range||5 pg/ml - 80 pg/ml!!Sensitivity||< 0.5 pg/ml
⇄⧉etc_term2 => string (374) "Intra-assay Precision||Four samples of known concentration were tested twent...
$value[8]['_source']['etc_term2']
Intra-assay Precision||Four samples of known concentration were tested twenty times on one plate to assess intra-assay precision. The CV (%)?9%.!!Inter-assay Precision||Three samples of known concentration were tested in twenty separate assays to assess inter-assay precision. Assays were performed by at least three technicians using two lots of components. The CV (%)?11%.
⇄⧉products_description => string (675) "Background: Human Protein Disulfide-isomerase A3 (PDIA3) ELISA Kit employs a...
$value[8]['_source']['products_description']
Background: Human Protein Disulfide-isomerase A3 (PDIA3) ELISA Kit employs a two-site sandwich ELISA to quantitate PDIA3 in samples. An antibody specific for Human PDIA3 has been pre-coated onto a microplate. Standards and samples are pipetted into the wells and any PDIA3 present is bound by the immobilized antibody. After removing any unbound substances, HRP-Conjugated PDIA3 detection antibody is added to the wells. Following a wash to remove any unbound HRP reagent, a Chromogen solution is added to the wells and color develops in proportion to the amount of PDIA3 bound in the initial step. The color development is stopped and the intensity of the color is measured.
Adaptive Immune System Pathway||1269171!!Antigen Presentation: Folding, Assembly And Peptide Loading Of Class I MHC Pathway||1269194!!Antigen Processing And Presentation Pathway||83074!!Antigen Processing And Presentation Pathway||485!!Antigen Processing-Cross Presentation Pathway||1269195!!Asparagine N-linked Glycosylation Pathway||1268714!!Calnexin/calreticulin Cycle Pathway||1268723!!Class I MHC Mediated Antigen Processing & Presentation Pathway||1269192!!ER-Phagosome Pathway||1269197!!Immune System Pathway||1269170
⇄⧉search_terms => string (1159) "aaa31491 human protein disulfide isomerase a3 pdia3 elisa kit has high sensi...
$value[8]['_source']['search_terms']
aaa31491 human protein disulfide isomerase a3 pdia3 elisa kit has high sensitivity and excellent specificity for detection of no significant cross reactivity or interference between analogues was observed typical testing data standard curve reference only fig.1 aaa31491_sc er60 erp57 erp60 erp61 grp57 grp58 hst17083 p58 pi plc 58 kda microsomal endoplasmic reticulum glucose regulated 58kda phospholipase c alpha family a member 3 hel s 269 93n er 60 resident 57 pdia3_human 21361657 np_005304.3 p30101 602046 assay type sandwich quantitative samples cell culture supernatants serum plasma other biological fluids method colorimetric usage notes * do not mix components from different lots use reagents beyond the expiration date allow all to warm room temperature at least 30 minutes before opening pre rinse pipet tip with reagent fresh tips each sample avoid contamination unused wells must be kept desiccated 4 degree in sealed bag provided thoroughly is very important result it recommended using low frequency oscillator slight hand shaking every 10 that standards assayed duplicate triplicate plc58 member3 s269 resident57 least30 desiccated4 every10
⇄⧉products_description => string (825) "Principle of the Assay: As mentioned above, this kit utilizes the Double Ant...
$value[9]['_source']['products_description']
Principle of the Assay: As mentioned above, this kit utilizes the Double Antibody Sandwich ELISA technique. The pre-coated antibody is an anti-Human PDI monoclonal antibody, while the detection antibody is a biotinylated polyclonal antibody. Samples and biotinylated antibodies are added into ELISA plate wells and washed out with PBS or TBS after their respective additions to the wells. Then Avidin-peroxidase conjugates are added to the wells in after. TMB substrate is used for coloration after the enzyme conjugate has already been thoroughly washed out of the wells by PBS or TBS. TMB reacts to form a blue product from the peroxidase activity, and finally turns to yellow after addition of the stop solution (Color Reagent C). The color intensity and quantity of target analyte in the sample are positively correlated.
⇄⧉search_terms => string (551) "aaa13007 human no cross reaction with other factors typical testing data sta...
$value[9]['_source']['search_terms']
aaa13007 human no cross reaction with other factors typical testing data standard curve for reference only aaa13007_sc elisa kit protein disulfide isomerase pdi isoform a cg6988 dmelcg6988 dpdi ep 3 1022 gene product from transcript re pa pe proline diisomerease disulphide 21,899 da pdi_drome 17647799 np_524079.1 p54399 nm_079355.3 q53yh5 q86pe2 q8iql8 q9vul7 samples serum plasma or cell culture supernatant assay type quantitative sandwich detection range 20 ng ml 0.312 sensitivity up to 0.06 intra precision <= 8 inter 12 ep3 range20 <=8 inter12
⇄⧉specificity => string (183) "This assay has high sensitivity and excellent specificity for detection of h...
$value[10]['_source']['specificity']
This assay has high sensitivity and excellent specificity for detection of human GREM2. No significant cross-reactivity or interference between human GREM2 and analogues was observed.
⇄purity => string (3) "N/A"
$value[10]['_source']['purity']
⇄form => string (3) "N/A"
$value[10]['_source']['form']
⇄concentration => string (3) "N/A"
$value[10]['_source']['concentration']
⇄⧉storage_stability => string (129) "Unopened test kits should be stored at 2 to 8 degree C upon receipt. Please ...
$value[10]['_source']['storage_stability']
Unopened test kits should be stored at 2 to 8 degree C upon receipt. Please refer to pdf manual for further storage instructions.
⇄⧉etc_term2 => string (328) "Intra-assay Precision||Intra-assay Precision (Precision within an assay): CV...
$value[10]['_source']['etc_term2']
Intra-assay Precision||Intra-assay Precision (Precision within an assay): CV%<15%. Three samples of known concentration were tested twenty times on one plate to assess.!!Inter-assay Precision||Inter-assay Precision (Precision between assays): CV%<15%. Three samples of known concentration were tested in twenty assays to assess.
Human Gremlin-2 (GREM2) ELISA kit; CKTSF1B2; DAND3; PRDC; cysteine knot superfamily 1; BMP antagonist 2; gremlin 2; protein related to DAN and cerberus; gremlin 2; cysteine knot superfamily; homolog (Xenopus laevis)
⇄products_gene_name => string (5) "GREM2"
$value[10]['_source']['products_gene_name']
⇄products_gene_name_syn => string (3) "N/A"
$value[10]['_source']['products_gene_name_syn']
⇄⧉products_description => string (653) "Principle of the Assay: This assay employs the competitive enzyme immunoassa...
$value[10]['_source']['products_description']
Principle of the Assay: This assay employs the competitive enzyme immunoassay technique. The microtiter plate provided in this kit has been pre-coated with goat-anti-rabbit antibody. Standards or samples are added to the appropriate microtiter plate wells with an antibody specific for GREM2 and Horseradish Peroxidase (HRP) conjugated GREM2. The competitive inhibition reaction is launched between with HRP labeled GREM2 and unlabeled GREM2 with the antibody. A substrate solution is added to the wells and the color develops in opposite to the amount of GREM2 in the sample. The color development is stopped and the intensity of the color is measured.
⇄⧉ncbi_protein_info => string (168) "gremlin-2; DAN domain family member 3; protein related to DAN and cerberus; ...
$value[10]['_source']['ncbi_protein_info']
gremlin-2; DAN domain family member 3; protein related to DAN and cerberus; cysteine knot superfamily 1, BMP antagonist 2; gremlin 2, cysteine knot superfamily, homolog
⇄ncbi_chrom_loc => string (3) "N/A"
$value[10]['_source']['ncbi_chrom_loc']
⇄ncbi_gene_id => string (5) "64388"
$value[10]['_source']['ncbi_gene_id']
⇄ncbi_mol_weight => string (9) "19,320 Da"
$value[10]['_source']['ncbi_mol_weight']
⇄ncbi_pathways => string (69) "Signal Transduction Pathway||477114!!Signaling By BMP Pathway||106336"
$value[10]['_source']['ncbi_pathways']
⇄sp_protein_name => string (9) "Gremlin-2"
$value[10]['_source']['sp_protein_name']
⇄⧉sp_protein_name_syn => string (110) "Cysteine knot superfamily 1, BMP antagonist 2; DAN domain family member 3; P...
$value[10]['_source']['sp_protein_name_syn']
Cysteine knot superfamily 1, BMP antagonist 2; DAN domain family member 3; Protein related to DAN and cerberus
⇄⧉search_terms => string (620) "aaa18396 human this assay has high sensitivity and excellent specificity for...
$value[10]['_source']['search_terms']
aaa18396 human this assay has high sensitivity and excellent specificity for detection of grem2 no significant cross reactivity or interference between analogues was observed typical testing data standard curve reference only aaa18396_td elisa kit gremlin 2 cysteine knot superfamily homolog xenopus laevis cktsf1b2 dand3 prdc 1 bmp antagonist protein related to dan cerberus family domain member 3 19,320 da grem2_human 71164892 np_071914.3 q9h772 nm_022469.3 q86ud9 608832 samples serum plasma tissue homogenates type quantitative competitive range 6.25 pg ml 2500 < intra precision within an cv gremlin2 prdc1 member3
⇄⧉products_description => string (836) "Principle of the Assay: As mentioned above, this kit utilizes the Double Ant...
$value[11]['_source']['products_description']
Principle of the Assay: As mentioned above, this kit utilizes the Double Antibody Sandwich ELISA technique. The pre-coated antibody is an anti-Porcine Testosterone monoclonal antibody, while the detection antibody is a biotinylated polyclonal antibody. Samples and biotinylated antibodies are added into ELISA plate wells and washed out with PBS or TBS after their respective additions to the wells. Then Avidin-peroxidase conjugates are added to the wells in after. TMB substrate is used for coloration after the enzyme conjugate has already been thoroughly washed out of the wells by PBS or TBS. TMB reacts to form a blue product from the peroxidase activity, and finally turns to yellow after addition of the stop solution (Color Reagent C). The color intensity and quantity of target analyte in the sample are positively correlated.
testosterone 17-beta-dehydrogenase 3; 17-beta-HSD3; 17-beta-HSD 3; 17-beta-hydroxysteroid dehydrogenase type 3; testicular 17-beta-hydroxysteroid dehydrogenase; short chain dehydrogenase/reductase family 12C, member 2
Androgen Biosynthesis Pathway||106154!!Fatty Acyl-CoA Biosynthesis Pathway||106115!!Fatty Acid, Triacylglycerol, And Ketone Body Metabolism Pathway||160977!!Metabolic Pathways||132956!!Metabolism Pathway||477135!!Metabolism Of Lipids And Lipoproteins Pathway||160976!!Metabolism Of Steroid Hormones And Vitamin D Pathway||106150!!Prostate Cancer Pathway||755440!!Steroid Biosynthesis Pathway||198866!!Steroid Hormone Biosynthesis Pathway||82940
⇄⧉search_terms => string (533) "aaa12681 porcine no cross reaction with other factors typical testing data s...
$value[11]['_source']['search_terms']
aaa12681 porcine no cross reaction with other factors typical testing data standard curve for reference only aaa12681_sc elisa kit testosterone 17 beta dehydrogenase 3 hydroxysteroid hsd17b3 edh17b3 sdr12c2 hsd3 hsd type testicular short chain reductase family 12c member 2 34,516 da dhb3_human 4557649 np_000188.1 p37058 nm_000197.1 605573 samples serum plasma or cell culture supernatant assay quantitative sandwich detection range 10 ng ml 0.156 sensitivity up to 0.05 intra precision testosterone17 dehydrogenase3 member2 range10
⇄⧉products_description => string (1328) "Intended Uses: This SMO ELISA kit is a 1.5 hour solid-phase ELISA designed f...
$value[12]['_source']['products_description']
Intended Uses: This SMO ELISA kit is a 1.5 hour solid-phase ELISA designed for the quantitative determination of Human SMO. This ELISA kit for research use only!<br><br>Principle of the Assay: SMO ELISA kit applies the competitive enzyme immunoassay technique utilizing a polyclonal anti-SMO antibody and an SMO-HRP conjugate. The assay sample and buffer are incubated together with SMO-HRP conjugate in pre-coated plate for one hour. After the incubation period, the wells are decanted and washed five times. The wells are then incubated with a substrate for HRP enzyme. The product of the enzyme-substrate reaction forms a blue colored complex. Finally, a stop solution is added to stop the reaction, which will then turn the solution yellow. The intensity of color is measured spectrophotometrically at 450nm in a microplate reader. The intensity of the color is inversely proportional to the SMO concentration since SMO from samples and SMO-HRP conjugate compete for the anti-SMO antibody binding site. Since the number of sites is limited, as more sites are occupied by SMO from the sample, fewer sites are left to bind SMO-HRP conjugate. A standard curve is plotted relating the intensity of the color (O.D.) to the concentration of standards. The SMO concentration in each sample is interpolated from this standard curve.
⇄products_references => string (3) "N/A"
$value[12]['_source']['products_references']
⇄⧉products_related_diseases => string (263) "Carcinoma, Basal Cell||131!!Nervous System Diseases||87!!Skin Neoplasms||61!...
⇄⧉search_terms => string (462) "aaa27318 human typical testing data standard curve for reference only aaa273...
$value[12]['_source']['search_terms']
aaa27318 human typical testing data standard curve for reference only aaa27318_td elisa kit smoothened homolog smo frizzled class receptor gx smoh fzd11 protein family member 11 seven transmembrane helix spanning 86,397 da smo_human 5032099 np_005622.1 q99835 nm_005631.4 a4d1k5 601500 cardiovascular samples serum plasma cell culture supernatants body fluid and tissue homogenate assay type quantitative competitive sensitivity 1.0 ng ml member11 sensitivity1.0
⇄specificity => string (65) "Recognizes human DNAJC10. Species Crossreactivity: mouse and rat."
$value[13]['_source']['specificity']
⇄purity => string (67) "Affinity Purified<br>Purified by Protein A affinity chromatography."
$value[13]['_source']['purity']
⇄form => string (36) "Supplied as a liquid in PBS, pH 7.2."
$value[13]['_source']['form']
⇄concentration => string (3) "N/A"
$value[13]['_source']['concentration']
⇄⧉storage_stability => string (270) "May be stored at 4 degree C for short-term only. Aliquot to avoid repeated f...
$value[13]['_source']['storage_stability']
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
⇄⧉app_tested => string (86) "ELISA (EL/EIA), Western Blot (WB), Immunohistochemistry (IHC), Immunofluores...
$value[13]['_source']['app_tested']
ELISA (EL/EIA), Western Blot (WB), Immunohistochemistry (IHC), Immunofluorescence (IF)
⇄⧉app_notes => string (193) "Suitable for use in Immunofluorescence, ELISA, Western Blot and Immunohistoc...
$value[13]['_source']['app_notes']
Suitable for use in Immunofluorescence, ELISA, Western Blot and Immunohistochemistry.<br>Dilution: Immunofluorescence: 10ug/ml<br>Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml
⇄⧉testing_protocols => string (907) "WB (Western Blot)||DNAJC10 monoclonal antibody. Western Blot analysis of DNA...
$value[13]['_source']['testing_protocols']
WB (Western Blot)||DNAJC10 monoclonal antibody. Western Blot analysis of DNAJC10 expression in HeLa.||AAA14783_WB7.jpg!!WB (Western Blot)||DNAJC10 monoclonal antibody. Western Blot analysis of DNAJC10 expression in Raw 264.7.||AAA14783_WB6.jpg!!Application Data||Detection limit for recombinant GST tagged DNAJC10 is ~10ng/ml as a capture antibody.||AAA14783_APP5.jpg!!IF (Immunofluorescence)||Immunofluorescence of monoclonal antibody to DNAJC10 on HeLa cell. [antibody concentration 10ug/ml].||AAA14783_IF4.jpg!!IHC (Immunohistochemistry)||Immunoperoxidase of monoclonal antibody to DNAJC10 on formalin-fixed paraffin-embedded human stomach. [antibody concentration 3ug/ml].||AAA14783_IHC3.jpg!!WB (Western Blot)||DNAJC10 monoclonal antibody. Western Blot analysis of DNAJC10 expression in NIH/3T3.||AAA14783_WB2.jpg!!WB (Western Blot)||Western Blot detection against Immunogen (37.77kD).||AAA14783_WB.jpg
⇄⧉etc_term1 => string (135) "Immunogen||Partial recombinant corresponding to aa688-794 from human DNAJC10...
$value[13]['_source']['etc_term1']
Immunogen||Partial recombinant corresponding to aa688-794 from human DNAJC10 (NP_061854) with GST tag. MW of the GST tag alone is 26kD.
⇄etc_term2 => string (3) "N/A"
$value[13]['_source']['etc_term2']
⇄products_price => string (6) "0.0000"
$value[13]['_source']['products_price']
⇄products_weight => string (4) "5.00"
$value[13]['_source']['products_weight']
⇄products_status => boolean true
$value[13]['_source']['products_status']
⇄products_tax_class_id => string (1) "1"
$value[13]['_source']['products_tax_class_id']
⇄manufacturers_id => string (3) "600"
$value[13]['_source']['manufacturers_id']
⇄products_ordered => string (1) "0"
$value[13]['_source']['products_ordered']
⇄language_id => string (1) "1"
$value[13]['_source']['language_id']
⇄products_name => string (7) "DNAJC10"
$value[13]['_source']['products_name']
⇄⧉products_name_oem => string (144) "DNAJC10 (DnaJ Homolog Subfamily C Member 10, ER-resident Protein ERdj5, Macr...
$value[13]['_source']['products_name_oem']
DNAJC10 (DnaJ Homolog Subfamily C Member 10, ER-resident Protein ERdj5, Macrothioredoxin, MTHr, ERDJ5, UNQ495/PRO1012, DKFZp434J1813, MGC104194)
⇄⧉products_name_syn => string (150) "Anti -DNAJC10 (DnaJ Homolog Subfamily C Member 10, ER-resident Protein ERdj5...
$value[13]['_source']['products_name_syn']
Anti -DNAJC10 (DnaJ Homolog Subfamily C Member 10, ER-resident Protein ERdj5, Macrothioredoxin, MTHr, ERDJ5, UNQ495/PRO1012, DKFZp434J1813, MGC104194)
⇄products_gene_name => string (3) "N/A"
$value[13]['_source']['products_gene_name']
⇄products_gene_name_syn => string (3) "N/A"
$value[13]['_source']['products_gene_name_syn']
⇄⧉products_description => string (172) "This endoplasmic reticulum co-chaperone may play a role in protein folding a...
$value[13]['_source']['products_description']
This endoplasmic reticulum co-chaperone may play a role in protein folding and translocation across the endoplasmic reticulum membrane. May act as a co-chaperone for HSPA5.
⇄⧉ncbi_protein_info => string (247) "dnaJ homolog subfamily C member 10; macrothioredoxin; ER-resident protein ER...
$value[13]['_source']['ncbi_protein_info']
dnaJ homolog subfamily C member 10; macrothioredoxin; ER-resident protein ERdj5; protein disulfide isomerase family A, member 19; endoplasmic reticulum DNA J domain-containing protein 5; J-domain-containing protein disulfide isomerase-like protein
⇄⧉search_terms => string (1263) "aaa14783 mouse human rat monoclonal igg1,k 3c4 affinity purified by protein ...
$value[13]['_source']['search_terms']
aaa14783 mouse human rat monoclonal igg1,k 3c4 affinity purified by protein a chromatography supplied as liquid in pbs ph 7.2 recognizes dnajc10 species crossreactivity and elisa el eia western blot wb immunohistochemistry ihc immunofluorescence if suitable for use dilution 10ug ml formalin fixed paraffin embedded 3ug detection against immunogen 37.77kd aaa14783_wb antibody analysis of expression nih 3t3 aaa14783_wb2 immunoperoxidase to on stomach concentration aaa14783_ihc3 hela cell aaa14783_if4 testing data limit recombinant gst tagged is ~10ng capture aaa14783_td5 raw 264.7 aaa14783_wb6 aaa14783_wb7 knhwvidfyapwcgpcqnfapefellarmikgkvkagkvdcqayaqtcqkagirayptvkfyfyerakrnfqeeqintrdakaiaalisekletlrnqgkrnkdel dnaj homolog subfamily c member 10 er resident erdj5 macrothioredoxin mthr unq495 pro1012 dkfzp434j1813 mgc104194 anti isoform 2 hsp40 jpdi pdia19 disulfide isomerase family 19 endoplasmic reticulum dna j domain containing 5 like 91,080 da djc10_human 409971397 np_001258510.1 q8ixb1 nm_001271581.1 q17rj6 q4zg06 q53qt7 q6uwz6 q86t61 q8nc82 q8td87 q96k38 q96k44 q96k54 q9nsy6 607987 antibodies abs heat shock proteins partial corresponding aa688 794 from np_061854 with tag mw the alone 26kd ph7.2 member10 isoform2 family19 containing5 aa688794
⇄⧉specificity => string (185) "This assay has high sensitivity and excellent specificity for detection of h...
$value[14]['_source']['specificity']
This assay has high sensitivity and excellent specificity for detection of human FERMT3. No significant cross-reactivity or interference between human FERMT3 and analogues was observed.
⇄purity => string (3) "N/A"
$value[14]['_source']['purity']
⇄form => string (3) "N/A"
$value[14]['_source']['form']
⇄concentration => string (3) "N/A"
$value[14]['_source']['concentration']
⇄⧉storage_stability => string (129) "Unopened test kits should be stored at 2 to 8 degree C upon receipt. Please ...
$value[14]['_source']['storage_stability']
Unopened test kits should be stored at 2 to 8 degree C upon receipt. Please refer to pdf manual for further storage instructions.
⇄⧉etc_term2 => string (327) "Intra-assay Precision||Intra-assay Precision (Precision within an assay): CV...
$value[14]['_source']['etc_term2']
Intra-assay Precision||Intra-assay Precision (Precision within an assay): CV%<8%. Three samples of known concentration were tested twenty times on one plate to assess.!!Inter-assay Precision||Inter-assay Precision (Precision between assays): CV%<10%. Three samples of known concentration were tested in twenty assays to assess.
⇄products_price => string (6) "0.0000"
$value[14]['_source']['products_price']
⇄products_weight => string (4) "5.00"
$value[14]['_source']['products_weight']
⇄products_status => boolean true
$value[14]['_source']['products_status']
⇄products_tax_class_id => string (1) "1"
$value[14]['_source']['products_tax_class_id']
⇄manufacturers_id => string (3) "700"
$value[14]['_source']['manufacturers_id']
⇄products_ordered => string (1) "0"
$value[14]['_source']['products_ordered']
⇄language_id => string (1) "1"
$value[14]['_source']['language_id']
⇄products_name => string (38) "fermitin family homolog 3 (Drosophila)"
Human Fermitin family homolog 3 (FERMT3) ELISA kit; KIND3; MGC10966; MIG-2; MIG2B; UNC112C; URP2; URP2SF; UNC-112 related protein 2; fermitin family homolog 3; kindlin 3; kindlin-3; fermitin family homolog 3 (Drosophila)
⇄products_gene_name => string (6) "FERMT3"
$value[14]['_source']['products_gene_name']
⇄products_gene_name_syn => string (3) "N/A"
$value[14]['_source']['products_gene_name_syn']
⇄⧉products_description => string (739) "Principle of the Assay: This assay employs the quantitative sandwich enzyme ...
$value[14]['_source']['products_description']
Principle of the Assay: This assay employs the quantitative sandwich enzyme immunoassay technique. Antibody specific for FERMT3 has been pre-coated onto a microplate. Standards and samples are pipetted into the wells and any FERMT3 present is bound by the immobilized antibody. After removing any unbound substances, a biotin-conjugated antibody specific for FERMT3 is added to the wells. After washing, avidin conjugated Horseradish Peroxidase (HRP) is added to the wells. Following a wash to remove any unbound avidin-enzyme reagent, a substrate solution is added to the wells and color develops in proportion to the amount of FERMT3 bound in the initial step. The color development is stopped and the intensity of the color is measured.
⇄products_references => string (3) "N/A"
$value[14]['_source']['products_references']
⇄⧉products_related_diseases => string (150) "Immune System Diseases||7!!LEUKOCYTE ADHESION DEFICIENCY, TYPE III||4!!Infla...
⇄⧉search_terms => string (844) "aaa18056 human this assay has high sensitivity and excellent specificity for...
$value[14]['_source']['search_terms']
aaa18056 human this assay has high sensitivity and excellent specificity for detection of fermt3 no significant cross reactivity or interference between analogues was observed typical testing data standard curve reference only aaa18056_td elisa kit fermitin family homolog 3 drosophila kind3 mgc10966 mig 2 mig2b unc112c urp2 urp2sf unc 112 related protein kindlin short form member mig2 like 75,953 da urp2_human 28626504 np_113659.3 q86ux7 nm_031471.5 q8iua1 q8n207 q9bt48 gene 612840 samples serum plasma tissue homogenates cell lysates type sandwich range 0.156 ng ml 10 0.039 intra precision within an cv is less than 8 three known concentration were tested twenty times on one plate to assess inter assays in wavelength 450 nm sample volume 50 100ul biological process 1 adhesion homolog3 unc112 ml10 than8 wavelength450 volume50 process1
⇄⧉products_description => string (834) "Principle of the Assay: As mentioned above, this kit utilizes the Double Ant...
$value[15]['_source']['products_description']
Principle of the Assay: As mentioned above, this kit utilizes the Double Antibody Sandwich ELISA technique. The pre-coated antibody is an anti-Mouse Testosterone monoclonal antibody, while the detection antibody is a biotinylated polyclonal antibody. Samples and biotinylated antibodies are added into ELISA plate wells and washed out with PBS or TBS after their respective additions to the wells. Then Avidin-peroxidase conjugates are added to the wells in after. TMB substrate is used for coloration after the enzyme conjugate has already been thoroughly washed out of the wells by PBS or TBS. TMB reacts to form a blue product from the peroxidase activity, and finally turns to yellow after addition of the stop solution (Color Reagent C). The color intensity and quantity of target analyte in the sample are positively correlated.
⇄products_references => string (3) "N/A"
$value[15]['_source']['products_references']
⇄⧉products_related_diseases => string (282) "Urogenital Abnormalities||21!!Disorders of Sex Development||19!!Genital Dise...
testosterone 17-beta-dehydrogenase 3; 17-beta-HSD3; 17-beta-HSD 3; 17-beta-hydroxysteroid dehydrogenase type 3; testicular 17-beta-hydroxysteroid dehydrogenase; short chain dehydrogenase/reductase family 12C, member 2
Androgen Biosynthesis Pathway||106154!!Fatty Acyl-CoA Biosynthesis Pathway||106115!!Fatty Acid, Triacylglycerol, And Ketone Body Metabolism Pathway||160977!!Metabolic Pathways||132956!!Metabolism Pathway||477135!!Metabolism Of Lipids And Lipoproteins Pathway||160976!!Metabolism Of Steroid Hormones And Vitamin D Pathway||106150!!Prostate Cancer Pathway||755440!!Steroid Biosynthesis Pathway||198866!!Steroid Hormone Biosynthesis Pathway||82940
⇄⧉search_terms => string (531) "aaa12981 mouse no cross reaction with other factors typical testing data sta...
$value[15]['_source']['search_terms']
aaa12981 mouse no cross reaction with other factors typical testing data standard curve for reference only aaa12981_sc elisa kit testosterone 17 beta dehydrogenase 3 hydroxysteroid hsd17b3 edh17b3 sdr12c2 hsd3 hsd type testicular short chain reductase family 12c member 2 34,516 da dhb3_human 4557649 np_000188.1 p37058 nm_000197.1 605573 samples serum plasma or cell culture supernatant assay quantitative sandwich detection range 10 ng ml 0.156 sensitivity up to 0.05 intra precision testosterone17 dehydrogenase3 member2 range10
WB (Western Blot)||WB Suggested Anti-PDIA6 Antibody Titration: 0.2-1 ug/ml<br>ELISA Titer: 1:1562500<br>Positive Control: HepG2 cell lysate.PDIA6 is strongly supported by BioGPS gene expression data to be expressed in HepG2||AAA23546_WB7.jpg!!WB (Western Blot)||Host: Rabbit<br>Target Name: PDIA6<br>Sample Type: MCF7<br>Antibody Dilution: 1.0ug/mlPDIA6 is strongly supported by BioGPS gene expression data to be expressed in MCF7||AAA23546_WB6.jpg!!WB (Western Blot)||Host: Rabbit<br>Target Name: PDIA6<br>Sample Type: Human Fetal Lung<br>Antibody Dilution: 1.0ug/ml||AAA23546_WB5.jpg!!WB (Western Blot)||Host: Rabbit<br>Target Name: PDIA6<br>Sample Type: Human Fetal Liver<br>Antibody Dilution: 1.0ug/ml||AAA23546_WB4.jpg!!WB (Western Blot)||Host: Rabbit<br>Target Name: PDIA6<br>Sample Type: Human Adult Placenta<br>Antibody Dilution: 1.0ug/ml||AAA23546_WB3.jpg!!WB (Western Blot)||Host: Rabbit<br>Target Name: PDIA6<br>Sample Type: 721_B<br>Antibody Dilution: 1.0ug/mlPDIA6 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells||AAA23546_WB2.jpg!!IHC (Immunohistochemistry)||Immunohistochemistry with Small intestine tissue||AAA23546_IHC.jpg
Homology||Cow: 100%; Dog: 86%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%!!Immunogen||The immunogen is a synthetic peptide directed towards the middle region of human PDIA6
⇄⧉products_description => string (1072) "This is a rabbit polyclonal antibody against PDIA6. It was validated on West...
$value[16]['_source']['products_description']
This is a rabbit polyclonal antibody against PDIA6. It was validated on Western Blot using a cell lysate as a positive control.<br><br>Target Description: Protein disulfide isomerases, such as PDIA6, are endoplasmic reticulum (ER) resident proteins that catalyze formation, reduction, and isomerization of disulfide bonds in proteins and are thought to play a role in folding of disulfide-bonded proteins.Protein disulfide isomerases (EC 5.3.4.1), such as PDIA6, are endoplasmic reticulum (ER) resident proteins that catalyze formation, reduction, and isomerization of disulfide bonds in proteins and are thought to play a role in folding of disulfide-bonded proteins (Hayano and Kikuchi, 1995 [PubMed 7590364]).[supplied by OMIM]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-39 BF979486.1 11-49 40-1858 BC001312.1 1-1819 1859-2326 AK127433.1 2215-2682 2327-2344 BM511594.1 1-18 c
⇄products_references => string (3) "N/A"
$value[16]['_source']['products_references']
⇄⧉products_related_diseases => string (186) "Nervous System Diseases||3!!Liver Diseases||2!!Kidney Diseases||2!!Inflammat...
⇄⧉search_terms => string (1052) "aaa23546 rabbit cow dog guinea pig horse human mouse rat polyclonal affinity...
$value[16]['_source']['search_terms']
aaa23546 rabbit cow dog guinea pig horse human mouse rat polyclonal affinity purified liquid antibody supplied in 1x pbs buffer with 0.09 w v sodium azide and 2 sucrose immunohistochemistry ihc western blot wb small intestine tissue aaa23546_ihc host target name pdia6 sample type 721_b dilution 1.0ug mlpdia6 is strongly supported by biogps gene expression data to be expressed cells aaa23546_wb2 adult placenta ml aaa23546_wb3 fetal liver aaa23546_wb4 lung aaa23546_wb5 mcf7 aaa23546_wb6 suggested anti titration 0.2 1 ug elisa titer 1:1562500 positive control hepg2 cell lysate.pdia6 aaa23546_wb7 synthetic peptide located within the following region klaavdatvnqvlasrygirgfptikifqkgespvdydggrtrsdivsra middle erp5 p5 txndc7 protein disulfide isomerase a6 isoform d family a member 6 48kda endoplasmic reticulum 5 er thioredoxin domain containing 7 pdia6_human 5031973 np_005733 q15084 nm_005742 611099 signal proteins drugs drug metabolism homology 100 86 93 immunogen directed towards of and2 titration0.2 member6 reticulum5 containing7 homology100
⇄form => string (76) "Lyophilized. Each vial contains 4mg Trehalose, 0.9mg NaCl and 0.2mg Na2HPO4."
$value[17]['_source']['form']
⇄concentration => string (3) "N/A"
$value[17]['_source']['concentration']
⇄⧉storage_stability => string (202) "Store at -20 degree C for one year. After reconstitution, at 4 degree C for ...
$value[17]['_source']['storage_stability']
Store at -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquotted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.
⇄⧉app_tested => string (158) "Western Blot (WB), Immunohistochemistry-Paraffin (IHC-P), Immunocytochemistr...
$value[17]['_source']['app_tested']
Western Blot (WB), Immunohistochemistry-Paraffin (IHC-P), Immunocytochemistry (ICC), Immunofluorescence (IF), Flow Cytometry (FC/FACS/FCM), Direct ELISA (EIA)
FCM (Flow Cytometry)||Figure 10. Flow Cytometry analysis of U20S cells using anti-PDIA5 antibody (AAA19331).<br>Overlay histogram showing U20S cells stained with AAA19331 (Blue line). The cells were blocked with 10% normal goat serum. And then incubated with rabbit anti-PDIA5 Antibody (AAA19331, 1μg/1x10<sup>6</sup> cells) for 30 min at 20 degree C. DyLight®488 conjugated goat anti-rabbit IgG (5-10μg/1x10<sup>6</sup> cells) was used as secondary antibody for 30 minutes at 20 degree C. Isotype control antibody (Green line) was rabbit IgG (1μg/1x10<sup>6</sup>) used under the same conditions. Unlabelled sample (Red line) was also used as a control.||AAA19331_FCM10.jpg!!IF (Immunofluorescence)||Figure 9. IF analysis of PDIA5 using anti- PDIA5 antibody (AAA19331).<br>PDIA5 was detected in immunocytochemical section of CACO-2 cells. Enzyme antigen retrieval was performed using IHC enzyme antigen retrieval reagent for 15 mins. The cells were blocked with 10% goat serum. And then incubated with 5μg/mL rabbit anti- PDIA5 Antibody (AAA19331) overnight at 4 degree C. DyLight®488 Conjugated Goat Anti-Rabbit IgG was used as secondary antibody at 1:100 dilution and incubated for 30 minutes at 37 degree C. The section was counterstained with DAPI. Visualize using a fluorescence microscope and filter sets appropriate for the label used.||AAA19331_IF9.jpg!!IHC (Immunohistochemistry)||Figure 8. IHC analysis of PDIA5 using anti-PDIA5 antibody (AAA19331).<br>PDIA5 was detected in paraffin-embedded section of human adrenocortical adenoma tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH8. 0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2μg/ml rabbit anti-PDIA5 Antibody (AAA19331) overnight at 4 degree C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37 degree C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) (Catalog # with DAB as the chromogen.||AAA19331_IHC8.jpg!!IHC (Immunohistochemistry)||Figure 7. IHC analysis of PDIA5 using anti-PDIA5 antibody (AAA19331).<br>PDIA5 was detected in paraffin-embedded section of human ovarian adenocarcinoma tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH8. 0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2μg/ml rabbit anti-PDIA5 Antibody (AAA19331) overnight at 4 degree C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37 degree C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) (Catalog # with DAB as the chromogen.||AAA19331_IHC7.jpg!!IHC (Immunohistchemistry)||Figure 6. IHC analysis of PDIA5 using anti-PDIA5 antibody (AAA19331).<br>PDIA5 was detected in paraffin-embedded section of human lung cancer tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH8. 0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2μg/ml rabbit anti-PDIA5 Antibody (AAA19331) overnight at 4 degree C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37 degree C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) (Catalog # with DAB as the chromogen.||AAA19331_IHC6.jpg!!IHC (Immunohistochemistry)||Figure 5. IHC analysis of PDIA5 using anti-PDIA5 antibody (AAA19331).<br>PDIA5 was detected in paraffin-embedded section of human rectal cancer tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH8. 0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2μg/ml rabbit anti-PDIA5 Antibody (AAA19331) overnight at 4 degree C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37 degree C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) (Catalog # with DAB as the chromogen.||AAA19331_IHC5.jpg!!IHC (Immunohistochemistry)||Figure 4. IHC analysis of PDIA5 using anti-PDIA5 antibody (AAA19331).<br>PDIA5 was detected in paraffin-embedded section of human gallbladder adenocarcinoma tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH8. 0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2μg/ml rabbit anti-PDIA5 Antibody (AAA19331) overnight at 4 degree C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37 degree C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) (Catalog # with DAB as the chromogen.||AAA19331_IHC4.jpg!!IHC (Immunohistochemistry)||Figure 3. IHC analysis of PDIA5 using anti-PDIA5 antibody (AAA19331).<br>PDIA5 was detected in paraffin-embedded section of human placenta tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH8. 0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2μg/ml rabbit anti-PDIA5 Antibody (AAA19331) overnight at 4 degree C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37 degree C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) (Catalog # with DAB as the chromogen.||AAA19331_IHC3.jpg!!IHC (Immunohistochemistry)||Figure 2. IHC analysis of PDIA5 using anti-PDIA5 antibody (AAA19331).<br>PDIA5 was detected in paraffin-embedded section of human breast cancer tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH8. 0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2μg/ml rabbit anti-PDIA5 Antibody (AAA19331) overnight at 4 degree C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37 degree C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) (Catalog # with DAB as the chromogen.||AAA19331_IHC2.jpg!!WB (Western Blot)||Figure 1. Western blot analysis of PDIA5 using anti-PDIA5 antibody (AAA19331).<br>Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 30ug of sample under reducing conditions.<br>Lane 1: human Hela whole cell lysates<br>Lane 2: human HepG2 whole cell lysates<br>Lane 3: human Caco-2 whole cell lysates<br>Lane 4: human THP-1 whole cell lysates<br>Lane 5: human MCF-7 whole cell lysates<br>Lane 6: human HL-60 whole cell lysates<br>Lane 7: human A431 whole cell lysates<br>Lane 8: human T47D whole cell lysates<br>Lane 9: rat liver tissue lysates<br>Lane 10: rat lung tissue lysates<br>Lane 11: rat stomach tissue lysates<br>Lane 12: rat pancreas tissue lysates<br>Lane 13: mouse liver tissue lysates<br>Lane 14: mouse lung tissue lysates<br>Lane 15: mouse stomach tissue lysates<br>Lane 16: mouse pancreas tissue lysates.<br>After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/ TBS for 1. 5 hour at RT. The membrane was incubated with rabbit anti-PDIA5 antigen affinity purified polyclonal antibody (Catalog # AAA19331) at 0. 25 μg/mL overnight at 4 degree C, then washed with TBS-0. 1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:5000 for 1. 5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit (Catalog # with Tanon 5200 system. A specific band was detected for PDIA5 at approximately 60KD. The expected band size for PDIA5 is at 60KD.||AAA19331_WB.jpg
⇄⧉etc_term1 => string (165) "Immunogen||E Coli-derived human PDIA5 recombinant protein (Position: R46-Y48...
$value[17]['_source']['etc_term1']
Immunogen||E Coli-derived human PDIA5 recombinant protein (Position: R46-Y481).!!Reconstitution||Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Recommended Detection Systems||Recommended Detection Systems||Lab recommends Enhanced Chemiluminescent Kit with anti-Rabbit IgG for Western blot, and HRP Conjugated anti-Rabbit IgG Super Vision Assay Kit for IHC(P) and ICC.
⇄⧉products_name_syn => string (150) "PDIA5; PDIR; Protein disulfide-isomerase A5; EC 5. 3. 4. 1; Protein disulfid...
$value[17]['_source']['products_name_syn']
PDIA5; PDIR; Protein disulfide-isomerase A5; EC 5. 3. 4. 1; Protein disulfide isomerase-related protein; protein disulfide isomerase family A member 5
⇄products_gene_name => string (5) "PDIA5"
$value[17]['_source']['products_gene_name']
⇄products_gene_name_syn => string (3) "N/A"
$value[17]['_source']['products_gene_name_syn']
⇄⧉products_description => string (594) "This gene encodes a member of the disulfide isomerase (PDI) family of endopl...
$value[17]['_source']['products_description']
This gene encodes a member of the disulfide isomerase (PDI) family of endoplasmic reticulum (ER) proteins that catalyze protein folding and thiol-disulfide interchange reactions. The encoded protein has an N-terminal ER-signal sequence, three catalytically active thioredoxin (TRX) domains, a TRX-like domain, and a C-terminal ER-retention sequence. The N-terminal TRX-like domain is the primary binding site for the major ER chaperone calreticulin and possibly other proteins and substrates as well. Alternative splicing results in multiple protein- and non-protein-coding transcript variants.
⇄⧉products_references => string (539) "1. Hartz, P. A. Personal Communication. Baltimore, Md. 5/9/2016.<br>2. Hayan...
$value[17]['_source']['products_references']
1. Hartz, P. A. Personal Communication. Baltimore, Md. 5/9/2016.<br>2. Hayano, T., Kikuchi, M. Molecular cloning of the cDNA encoding a novel protein disulfide isomerase-related protein (PDIR). FEBS Lett. 372: 210-214, 1995.<br>3. Higa, A., Taouji, S., Lhomond, S., Jensen, D., Fernandez-Zapico, M. E., Simpson, J. C., Pasquet, J. -M., Schekman, R., Chevet, E. Endoplasmic reticulum stress-activated transcription factor ATF6-alpha requires the disulfide isomerase PDIA5 to modulate chemoresistance. Molec. Cell. Biol. 34: 1839-1849, 2014.
⇄⧉search_terms => string (2244) "aaa19331 rabbit human mouse rat polyclonal igg immunogen affinity purified l...
$value[17]['_source']['search_terms']
aaa19331 rabbit human mouse rat polyclonal igg immunogen affinity purified lyophilized each vial contains 4mg trehalose 0.9mg nacl and 0.2mg na2hpo4 antibody for pdia5 detection western blot wb immunohistochemistry paraffin ihc p immunocytochemistry icc immunofluorescence if flow cytometry fc facs fcm direct elisa eia 0.1 0.25ug ml|human rat| 2 5ug ml|human| 1 3ug 1x106 cells|human| 0.5ug figure analysis of using anti electrophoresis was performed on a 5 20 sds page gel at 70v stacking 90v resolving 3 hours the sample well lane loaded with 30ug under reducing conditions hela whole cell lysates hepg2 caco 4 thp mcf 7 6 hl 60 a431 8 t47d 9 liver tissue 10 lung 11 stomach 12 pancreas 13 14 15 16 after proteins were transferred to nitrocellulose membrane 150ma 50 90 minutes blocked non fat milk tbs hour rt incubated antigen catalog # 0 25 &mu g ml overnight degree c then washed tween times probed goat hrp secondary dilution 1:5000 signal is developed an enhanced chemiluminescent ecl kit mbs176460 tanon 5200 system specific band detected approximately 60kd expected size aaa19331_wb in embedded section breast cancer heat mediated retrieval edta buffer ph8 epitope solution serum 2&mu biotinylated used as 30 37 strepavidin biotin complex sabc mbs176451 dab chromogen aaa19331_ihc2 placenta aaa19331_ihc3 gallbladder adenocarcinoma aaa19331_ihc4 rectal aaa19331_ihc5 aaa19331_ihc6 ovarian aaa19331_ihc7 adrenocortical adenoma aaa19331_ihc8 immunocytochemical cells enzyme reagent mbs176582 mins 5&mu dylight® 488 conjugated 1:100 counterstained dapi visualize fluorescence microscope filter sets appropriate label aaa19331_if9 u20s overlay histogram showing stained blue line normal 1&mu 1x10<sup>6< sup> min 10&mu isotype control green same unlabelled red also aaa19331_fc10 pdir protein disulfide isomerase a5 ec related family member associated 30,124 da pdia5_human 5803121 np_006801 q14554 nm_006810 q9bv43 d3dn95 e coli derived recombinant position r46 y481 reconstitution add 0.2ml distilled water will yield concentration 500ug recommended systems lab recommends super vision assay mbs176453 eia0.1 rat|2 ml|human|1 resolving3 caco4 mcf7 hl60 a4318 t47d9 tissue10 lung11 stomach12 pancreas13 150ma50 #0 as30 dylight®488
⇄⧉storage_stability => string (202) "For unopened kit, all reagents should be kept according to the labels on via...
$value[18]['_source']['storage_stability']
For unopened kit, all reagents should be kept according to the labels on vials. The TMB Substrate, Wash Buffer, Stop Solution should be stored at 4 degree C. All others should be stored at -20 degree C.
⇄⧉search_terms => string (580) "aaa13932 human typical testing data standard curve for reference only aaa139...
$value[18]['_source']['search_terms']
aaa13932 human typical testing data standard curve for reference only aaa13932_td elisa kit mannose receptor c type 2 mrc2 pkc2 pkc z prkcz protein kinase m zeta cd280 uparap clec13e endo180 166,674 da lectin domain family 13 member e endocytic 180 macrophage urokinase plasminogen activator associated upar cd_antigen kiaa0709 110624774 np_006030.2 q9ubg0 nm_006039.4 q7lge7 q9y5p9 a6h8k4 d3du08 af107292 mrna samples serum plasma tissue homogenates and other biological fluids assay sandwich detection range 0.312 20ng ml sensitivity 0.117ng intra cv type2 family13 endocytic180
Assay Type||Quantitative Sandwich!!Samples||Serum, plasma, cell culture supernates, Ascites, tissue homogenates or other biological fluids!!Detection Range||5-1000ng/ml!!Sensitivity||2.43ng/ml
⇄⧉etc_term2 => string (403) "Intra-assay Precision||Intra-Assay Precision (Precision within an assay) Thr...
$value[19]['_source']['etc_term2']
Intra-assay Precision||Intra-Assay Precision (Precision within an assay) Three samples of known concentration were tested on one plate to assess intra-assay precision. Intra-Assay: CV<8%!!Inter-assay Precision||Inter-Assay Precision (Precision between assays) Three samples of known concentration were tested in separate assays to assess inter-assay precision. CV(%) = SD/mean x 100. Inter-Assay: CV<10%
⇄⧉products_description => string (889) "Principle of the Assay: This kit is an Enzyme-Linked Immunosorbent Assay (EL...
$value[19]['_source']['products_description']
Principle of the Assay: This kit is an Enzyme-Linked Immunosorbent Assay (ELISA). The plate has been pre-coated with Mouse 2-AG antibody. 2-AG present in the sample is added and binds to antibodies coated on the wells. And then biotinylated Mouse 2-AG Antibody is added and binds to 2-AG in the sample. Then Streptavidin-HRP is added and binds to the Biotinylated 2-AG antibody. After incubation unbound Streptavidin-HRP is washed away during a washing step. Substrate solution is then added and color develops in proportion to the amount of Mouse 2-AG. The reaction is terminated by addition of acidic stop solution and absorbance is measured at 450 nm.<br><br>Intended Uses: This sandwich kit is for the accurate quantitative detection of Mouse 2-Arachidonoylglycerol (also known as 2-AG) in serum, plasma, cell culture supernates, Ascites, tissue homogenates or other biological fluids.
⇄⧉search_terms => string (434) "aaa18968 mouse typical testing data standard curve for reference only aaa189...
$value[19]['_source']['search_terms']
aaa18968 mouse typical testing data standard curve for reference only aaa18968_sc elisa kit 2 arachidonoylglycerol ag samples serum plasma cell culture supernates lysates tissue homogenates assay type quantitative sandwich detection range 5ng ml 1000ng sensitivity 2.43ng intra precision within an three of known concentration were tested on one plate to assess cv<8 inter between assays in separate cv = sd mean x 100 cv<10 kit2 x100
