Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of RAD23B expression in transfected 293T cell line by RAD23B monoclonal antibody. Lane 1: RAD23B transfected lysate (43.2kD). Lane 2: Non-transfected lysate.)

Mouse anti-Human RAD23B Monoclonal Antibody | anti-RAD23B antibody

RAD23B (UV Excision Repair Protein RAD23 Homolog B, XP-C Repair-complementing Complex 58kD Protein, hHR23B, HR23B, p58) (FITC)

Gene Names
RAD23B; P58; HR23B; HHR23B
Reactivity
Human
Applications
ELISA, Immunohistochemistry, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
RAD23B; Monoclonal Antibody; RAD23B (UV Excision Repair Protein RAD23 Homolog B; XP-C Repair-complementing Complex 58kD Protein; hHR23B; HR23B; p58) (FITC); anti-RAD23B antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
3H7
Specificity
Recognizes human RAD23B.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Applicable Applications for anti-RAD23B antibody
ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
Application Notes
IHC-P: 3ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa311-410, from human RAD23B (NP_002865) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
PQLLQQISQHQEHFIQMLNEPVQEAGGQGGGGGGGSGGIAEAGSGHMNYIQVTPQEKEAIERLKALGFPEGLVIQAYFACEKNENLAANFLLQQNFDED
Conjugate
FITC
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of RAD23B expression in transfected 293T cell line by RAD23B monoclonal antibody. Lane 1: RAD23B transfected lysate (43.2kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of RAD23B expression in transfected 293T cell line by RAD23B monoclonal antibody. Lane 1: RAD23B transfected lysate (43.2kD). Lane 2: Non-transfected lysate.)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to RAD23B on formalin-fixed paraffin-embedded human liver. [antibody concentration 3ug/ml])

Immunohistochemistry (IHC) (Immunoperoxidase of monoclonal antibody to RAD23B on formalin-fixed paraffin-embedded human liver. [antibody concentration 3ug/ml])

Testing Data

(Detection limit for recombinant GST tagged RAD23B is 0.1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged RAD23B is 0.1ng/ml as a capture antibody.)
Product Categories/Family for anti-RAD23B antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
35,005 Da
NCBI Official Full Name
UV excision repair protein RAD23 homolog B isoform 1
NCBI Official Synonym Full Names
RAD23 homolog B (S. cerevisiae)
NCBI Official Symbol
RAD23B
NCBI Official Synonym Symbols
P58; HR23B; HHR23B
NCBI Protein Information
UV excision repair protein RAD23 homolog B; RAD23, yeast homolog of, B; XP-C repair complementing complex 58 kDa; XP-C repair complementing protein; XP-C repair-complementing complex 58 kDa protein
UniProt Protein Name
UV excision repair protein RAD23 homolog B
Protein Family
UniProt Gene Name
RAD23B
UniProt Synonym Gene Names
HR23B; hHR23B; p58
UniProt Entry Name
RD23B_HUMAN

Uniprot Description

RAD23B: Multiubiquitin chain receptor involved in modulation of proteasomal degradation. Binds to polyubiquitin chains. Proposed to be capable to bind simultaneously to the 26S proteasome and to polyubiquitinated substrates and to deliver ubiquitinated proteins to the proteasome. May play a role in endoplasmic reticulum- associated degradation (ERAD) of misfolded glycoproteins by association with PNGase and delivering deglycosylated proteins to the proteasome. Belongs to the RAD23 family.

Protein type: Motility/polarity/chemotaxis

Chromosomal Location of Human Ortholog: 9q31.2

Cellular Component: nucleoplasm; proteasome complex; cytoplasm; nucleus

Molecular Function: protein binding; damaged DNA binding; polyubiquitin binding; single-stranded DNA binding

Biological Process: nucleotide-excision repair, DNA damage recognition; proteasomal ubiquitin-dependent protein catabolic process; nucleotide-excision repair; regulation of proteasomal ubiquitin-dependent protein catabolic process; spermatogenesis; nucleotide-excision repair, DNA damage removal; DNA repair

Similar Products

Product Notes

The RAD23B rad23b (Catalog #AAA6149203) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The RAD23B (UV Excision Repair Protein RAD23 Homolog B, XP-C Repair-complementing Complex 58kD Protein, hHR23B, HR23B, p58) (FITC) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's RAD23B can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB). IHC-P: 3ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the RAD23B rad23b for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "RAD23B, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.