Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of TMEM11 expression in transfected 293T cell line by TMEM11 polyclonal antibody. Lane 1: TMEM11 transfected lysate (21.5kD). Lane 2: Non-transfected lysate.)

Mouse anti-Human TMEM11 Polyclonal Antibody | anti-TMEM11 antibody

TMEM11 (Transmembrane Protein 11, Mitochondrial, C17orf35, Protein PM1, Protein PMI, PM1, PMI)

Gene Names
TMEM11; PM1; PMI; C17orf35
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
TMEM11; Polyclonal Antibody; TMEM11 (Transmembrane Protein 11; Mitochondrial; C17orf35; Protein PM1; Protein PMI; PM1; PMI); Anti -TMEM11 (Transmembrane Protein 11; anti-TMEM11 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human TMEM11.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
MAAWGRRRLGPGSSGGSARERVSLSATDCYIVHEIYNGENAQDQFEYELEQALEAQYKYIVIEPTRIGDETARWITVGNCLHKTAVLAGTACLFTPLALPLDYSHYISLPAGVLSLACCTLYGISWQFDPCCKYQVEYDAYKLSRLPLHTLTSSTPVVLVRKDDLHRKRLHNTIALAALVYCVKKIYELYAV
Applicable Applications for anti-TMEM11 antibody
Western Blot (WB)
Application Notes
Suitable for use in Western Blot.
Immunogen
Full length human TMEM11, aa1-192 (NP_003867.1).
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of TMEM11 expression in transfected 293T cell line by TMEM11 polyclonal antibody. Lane 1: TMEM11 transfected lysate (21.5kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of TMEM11 expression in transfected 293T cell line by TMEM11 polyclonal antibody. Lane 1: TMEM11 transfected lysate (21.5kD). Lane 2: Non-transfected lysate.)
Product Categories/Family for anti-TMEM11 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
21,541 Da
NCBI Official Full Name
transmembrane protein 11, mitochondrial
NCBI Official Synonym Full Names
transmembrane protein 11
NCBI Official Symbol
TMEM11
NCBI Official Synonym Symbols
PM1; PMI; C17orf35
NCBI Protein Information
transmembrane protein 11, mitochondrial; putative receptor protein
UniProt Protein Name
Transmembrane protein 11, mitochondrial
Protein Family
UniProt Gene Name
TMEM11
UniProt Synonym Gene Names
C17orf35; PM1
UniProt Entry Name
TMM11_HUMAN

Uniprot Description

Function: Plays a role in mitochondrial morphogenesis. Ref.8

Subcellular location: Mitochondrion inner membrane; Multi-pass membrane protein Ref.8.

Sequence similarities: Belongs to the TMEM11 family.

Research Articles on TMEM11

Similar Products

Product Notes

The TMEM11 tmem11 (Catalog #AAA648226) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The TMEM11 (Transmembrane Protein 11, Mitochondrial, C17orf35, Protein PM1, Protein PMI, PM1, PMI) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's TMEM11 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Suitable for use in Western Blot. Researchers should empirically determine the suitability of the TMEM11 tmem11 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MAAWGRRRLG PGSSGGSARE RVSLSATDCY IVHEIYNGEN AQDQFEYELE QALEAQYKYI VIEPTRIGDE TARWITVGNC LHKTAVLAGT ACLFTPLALP LDYSHYISLP AGVLSLACCT LYGISWQFDP CCKYQVEYDA YKLSRLPLHT LTSSTPVVLV RKDDLHRKRL HNTIALAALV YCVKKIYELY AV. It is sometimes possible for the material contained within the vial of "TMEM11, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.