Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: TMEFF1Sample Type: 786-0 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

Rabbit anti-Human TMEFF1 Polyclonal Antibody | anti-TMEFF1 antibody

TMEFF1 Antibody - N-terminal region

Gene Names
MSANTD3-TMEFF1; TR-1; H7365; C9orf2; TMEFF1; C9orf3-TMEFF1; C9orf30-TMEFF1
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
TMEFF1; Polyclonal Antibody; TMEFF1 Antibody - N-terminal region; anti-TMEFF1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MLPEQLYFLQSPPEEEPEYHPDASAQELNVRESDVRVCDESSCKYGGVCK
Sequence Length
341
Applicable Applications for anti-TMEFF1 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of Human TMEFF1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: TMEFF1Sample Type: 786-0 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: TMEFF1Sample Type: 786-0 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-TMEFF1 antibody
This is a rabbit polyclonal antibody against TMEFF1. It was validated on Western Blot

Target Description: TMEFF1 may inhibit NODAL and BMP signaling during neural patterning. It may be a tumor suppressor in brain cancers.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
37kDa
NCBI Official Full Name
MSANTD3-TMEFF1 fusion protein
NCBI Official Synonym Full Names
MSANTD3-TMEFF1 readthrough
NCBI Official Symbol
MSANTD3-TMEFF1
NCBI Official Synonym Symbols
TR-1; H7365; C9orf2; TMEFF1; C9orf3-TMEFF1; C9orf30-TMEFF1
NCBI Protein Information
MSANTD3-TMEFF1 fusion protein
UniProt Protein Name
Tomoregulin-1
Protein Family
UniProt Gene Name
TMEFF1
UniProt Synonym Gene Names
C9orf2; TR-1
UniProt Entry Name
TEFF1_HUMAN

NCBI Description

This locus represents naturally occurring read-through transcription from the neighboring MSANTD3 (Myb/SANT-like DNA-binding domain containing 3) and TMEFF1 (transmembrane protein with EGF-like and two follistatin-like domains 1) genes. The read-through transcript encodes a fusion protein that shares sequence identity with the products of each individual gene. [provided by RefSeq, Aug 2013]

Uniprot Description

TMEFF1: a single-pass type I membrane protein. May inhibit NODAL and BMP signaling during neural patterning. A member of the Cancer-Testis Antigen (CTA) superfamily. CTAs may play roles in embryonal development and tumor transformation or aspects of tumor progression. CTAs were once thought to be silenced in most normal adult tissues, with limited expression in fetal, placental, testis, and ovarian cells. These proteins are now known to be aberrantly expressed in various cancers and many are capable of eliciting humoral and cellular immune responses. Expressed predominantly in brain, and at lower levels in heart, placenta and skeletal muscle. Down-regulated in brain tumors as compared to control brain tissues. Expressed in a variety of cancers cell lines and in myeloma cells. Belongs to the tomoregulin family. Two isoforms of the human protein are produced by alternative splicing. Note: This description may include information from RefSeq and UniProtKB

Protein type: Cancer Testis Antigen (CTA); Membrane protein, integral

Chromosomal Location of Human Ortholog: 9q31

Cellular Component: plasma membrane; integral to membrane

Biological Process: multicellular organismal development

Similar Products

Product Notes

The TMEFF1 tmeff1 (Catalog #AAA3219375) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TMEFF1 Antibody - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's TMEFF1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the TMEFF1 tmeff1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MLPEQLYFLQ SPPEEEPEYH PDASAQELNV RESDVRVCDE SSCKYGGVCK. It is sometimes possible for the material contained within the vial of "TMEFF1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.