Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (36.74kD).)

Mouse anti-Human IGFBP1 Monoclonal Antibody | anti-IGFBP1 antibody

IGFBP1 (Insulin-like Growth Factor-binding Protein 1, IBP-1, IGF-binding Protein 1, IGFBP-1, Placental Protein 12, PP12, IBP1) (Biotin)

Gene Names
IGFBP1; AFBP; IBP1; PP12; IGF-BP25; hIGFBP-1
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
IGFBP1; Monoclonal Antibody; IGFBP1 (Insulin-like Growth Factor-binding Protein 1; IBP-1; IGF-binding Protein 1; IGFBP-1; Placental Protein 12; PP12; IBP1) (Biotin); anti-IGFBP1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
2F9
Specificity
Recognizes human IGFBP1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Sequence Length
259
Applicable Applications for anti-IGFBP1 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa160-259 from human IGFBP1 (NP_000587) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
GSKALHVTNIKKWKEPCRIELYRVVESLAKAQETSGEEISKFYLPNCNKNGFYHSRQCETSMDGEAGLCWCVYPWNGKRIPGSPEIRGDPNCQIYFNVQN
Conjugate
Biotin
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.74kD).)

Western Blot (WB) (Western Blot detection against Immunogen (36.74kD).)
Related Product Information for anti-IGFBP1 antibody
Human IGF-BP1 is a cysteine-rich secreted protein expressed in liver, decidual, and kidneys and is the most abundant IGF-BP in amniotic fluid. Levels of IGF-BP1 in serum are lowest after food. IGF-BP1 binds both IGF-I and IGF-II with equal affinity. Phosphorylated IGF-BP1 hinders IGF actions, whereas nonphosphorylated IGF-BP1 is stimulatory.
Product Categories/Family for anti-IGFBP1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
insulin-like growth factor-binding protein 1
NCBI Official Synonym Full Names
insulin like growth factor binding protein 1
NCBI Official Symbol
IGFBP1
NCBI Official Synonym Symbols
AFBP; IBP1; PP12; IGF-BP25; hIGFBP-1
NCBI Protein Information
insulin-like growth factor-binding protein 1
UniProt Protein Name
Insulin-like growth factor-binding protein 1
UniProt Gene Name
IGFBP1
UniProt Synonym Gene Names
IBP1; IBP-1; IGF-binding protein 1; IGFBP-1; PP12
UniProt Entry Name
IBP1_HUMAN

NCBI Description

This gene is a member of the insulin-like growth factor binding protein (IGFBP) family and encodes a protein with an IGFBP N-terminal domain and a thyroglobulin type-I domain. The encoded protein, mainly expressed in the liver, circulates in the plasma and binds both insulin-like growth factors (IGFs) I and II, prolonging their half-lives and altering their interaction with cell surface receptors. This protein is important in cell migration and metabolism. Low levels of this protein may be associated with impaired glucose tolerance, vascular disease and hypertension in human patients. [provided by RefSeq, Aug 2017]

Uniprot Description

IGFBP1: IGF-binding proteins prolong the half-life of the IGFs and have been shown to either inhibit or stimulate the growth promoting effects of the IGFs on cell culture. They alter the interaction of IGFs with their cell surface receptors. Promotes cell migration.

Protein type: Secreted, signal peptide; Secreted

Chromosomal Location of Human Ortholog: 7p12.3

Cellular Component: extracellular space; extracellular region

Molecular Function: insulin-like growth factor binding; insulin-like growth factor I binding; insulin-like growth factor II binding

Biological Process: cellular protein metabolic process; regulation of insulin-like growth factor receptor signaling pathway; unfolded protein response, activation of signaling protein activity; unfolded protein response; tissue regeneration; insulin receptor signaling pathway; signal transduction; positive regulation of cell growth

Research Articles on IGFBP1

Similar Products

Product Notes

The IGFBP1 igfbp1 (Catalog #AAA6142433) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The IGFBP1 (Insulin-like Growth Factor-binding Protein 1, IBP-1, IGF-binding Protein 1, IGFBP-1, Placental Protein 12, PP12, IBP1) (Biotin) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's IGFBP1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the IGFBP1 igfbp1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "IGFBP1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.