Western Blot (WB)
(WB Suggested Anti-TMBIM4 AntibodyTitration: 1.0 ug/mlPositive Control: Placenta)
Rabbit TMBIM4 Polyclonal Antibody | anti-TMBIM4 antibody
TMBIM4 Antibody - middle region
Gene Names
TMBIM4; S1R; GAAP; LFG4; ZPRO; CGI-119
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
TMBIM4; Polyclonal Antibody; TMBIM4 Antibody - middle region; anti-TMBIM4 antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: LTVAVVVTFYDVYIILQAFILTTTVFFGLTVYTLQSKKDFSKFGAGLFAL
Sequence Length
258
Applicable Applications for anti-TMBIM4 antibody
Western Blot (WB)
Homology
Cow: 93%; Dog: 93%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 86%; Rabbit: 93%; Rat: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of Human TMBIM4
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-TMBIM4 AntibodyTitration: 1.0 ug/mlPositive Control: Placenta)
Western Blot (WB)
(WB Suggested Anti-TMBIM4 AntibodyTitration: 1.0 ug/mlPositive Control: Placenta)
Related Product Information for anti-TMBIM4 antibody
This is a rabbit polyclonal antibody against TMBIM4. It was validated on Western Blot
Target Description: TMBIM4 is an anti-apoptotic protein which can inhibit apoptosis induced by intrinsic and extrinsic apoptotic stimuli. It can modulate both capacitative Ca2+ entry and inositol 1,4,5-trisphosphate (IP3)-mediated Ca2+ release.
Target Description: TMBIM4 is an anti-apoptotic protein which can inhibit apoptosis induced by intrinsic and extrinsic apoptotic stimuli. It can modulate both capacitative Ca2+ entry and inositol 1,4,5-trisphosphate (IP3)-mediated Ca2+ release.
Product Categories/Family for anti-TMBIM4 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
28kDa
NCBI Official Full Name
protein lifeguard 4 isoform b
NCBI Official Synonym Full Names
transmembrane BAX inhibitor motif containing 4
NCBI Official Symbol
TMBIM4
NCBI Official Synonym Symbols
S1R; GAAP; LFG4; ZPRO; CGI-119
NCBI Protein Information
protein lifeguard 4
UniProt Protein Name
Protein lifeguard 4
Protein Family
UniProt Gene Name
TMBIM4
UniProt Synonym Gene Names
GAAP; LFG4
UniProt Entry Name
LFG4_HUMAN
Uniprot Description
Function: Anti-apoptotic protein which can inhibit apoptosis induced by intrinsic and extrinsic apoptotic stimuli. Can modulate both capacitative Ca2+ entry and inositol 1,4,5-trisphosphate (IP3)-mediated Ca2+ release. Ref.7 Ref.9
Subunit structure: Interacts with ITPR3. Ref.9
Subcellular location: Golgi apparatus membrane; Multi-pass membrane protein Ref.7 Ref.10.
Sequence similarities: Belongs to the BI1 family. LFG subfamily.
Sequence caution: The sequence AAD34114.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.
Research Articles on TMBIM4
Similar Products
Product Notes
The TMBIM4 tmbim4 (Catalog #AAA3217308) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TMBIM4 Antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's TMBIM4 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the TMBIM4 tmbim4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: LTVAVVVTFY DVYIILQAFI LTTTVFFGLT VYTLQSKKDF SKFGAGLFAL. It is sometimes possible for the material contained within the vial of "TMBIM4, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
