Rabbit anti-Human TIFA Polyclonal Antibody | anti-TIFA antibody

TIFA Antibody - middle region

Cat. Num. AAA3221248

• Gene Names: TIFA; T2BP; T6BP; TIFAA
• Reactivity: Human
• Applications: Western Blot
• Purity: Affinity purified
• Synonyms: TIFA; Polyclonal Antibody; TIFA Antibody - middle region; anti-TIFA antibody

• Host: Rabbit
• Reactivity: Human
• Clonality: Polyclonal
• Purity/Purification: Affinity purified
• Form/Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Sequence: Synthetic peptide located within the following region: FGRNSNICHYTFQDKQVSRVQFSLQLFKKFNSSVLSFEIKNMSKKTNLIV
• Sequence Length: 184

• Applicable Applications for anti-TIFA antibody: Western Blot (WB)
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human TIFA
• Preparation and Storage: For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: TIFASample Tissue: Human Hela Whole Cell lysatesAntibody Dilution: 1ug/ml)

Related Product Information for anti-TIFA antibody

Adapter protein which mediates the IRAK1 and TRAF6 interaction following IL-1 stimulation, resulting in the downstream activation of NF-kappa-B and AP-1 pathways. Induces the oligomerization and polyubiquitination of TRAF6, which leads to the activation of TAK1 and IKK through a proteasome-independent mechanism.

Product Categories/Family for anti-TIFA antibody

Polyclonal; Transcription Factor; Transcription Regulation; Protein Kinases; Signaling Intermediate; E3 & Ubiquitin; DNA/RNA/Protein Interactions

NCBI and Uniprot Product Information

• NCBI GI #: 33563370
• NCBI GeneID: 92610
• NCBI Accession #: NP_443096.1
• NCBI GenBank Nucleotide #: NM_052864.2
• UniProt Accession #: Q96CG3
• Molecular Weight: 20 kDa
• NCBI Official Full Name: TRAF-interacting protein with FHA domain-containing protein A
• NCBI Official Synonym Full Names: TRAF interacting protein with forkhead associated domain
• NCBI Official Symbol: TIFA
• NCBI Official Synonym Symbols: T2BP; T6BP; TIFAA
• NCBI Protein Information: TRAF-interacting protein with FHA domain-containing protein A
• UniProt Protein Name: TRAF-interacting protein with FHA domain-containing protein A
• Protein Family: TRAF-interacting protein with FHA domain-containing protein
• UniProt Gene Name: TIFA
• UniProt Synonym Gene Names: T2BP
• UniProt Entry Name: TIFA_HUMAN

NCBI Description

This gene encodes an adapter protein involved in adaptive and innate immunity. This protein includes a forkhead-associated (FHA) domain that specifically binds to phosphorylated serine and threonine residues. In response to bacterial infection, the encoded host cell protein undergoes an intermolecular interaction between the FHA domain and a phosphorylated threonine that leads to protein oligomerization and stimulation of the NF-kappa B and other downstream signaling pathways. This protein exhibits reduced expression in hepatocellular carcinoma and may suppress hepatocellular carcinoma progression. This protein may also play a role in the DNA damage response. [provided by RefSeq, Jun 2018]

Uniprot Description

TIFA: Adapter protein which mediates the IRAK1 and TRAF6 interaction following IL-1 stimulation, resulting in the downstream activation of NF-kappa-B and AP-1 pathways. Induces the oligomerization and polyubiquitination of TRAF6, which leads to the activation of TAK1 and IKK through a proteasome-independent mechanism.

Chromosomal Location of Human Ortholog: 4q25

Molecular Function: protein binding

Biological Process: I-kappaB kinase/NF-kappaB cascade