Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: Irak1bp1Sample Type: Mouse Testis lysatesAntibody Dilution: 1.0ug/ml)

Rabbit Irak1bp1 Polyclonal Antibody | anti-IRAK1BP1 antibody

Irak1bp1 Antibody - C-terminal region

Gene Names
Irak1bp1; Aabp3; Aip70; Simpl; AI851240; 4921528N06Rik
Reactivity
Dog, Horse, Human, Mouse, Pig, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
Irak1bp1; Polyclonal Antibody; Irak1bp1 Antibody - C-terminal region; anti-IRAK1BP1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Dog, Horse, Human, Mouse, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: WEGQTDDHQLSRLPGTLTVQQKIKSATIHAASKVFITFEVKGKEKKKKHL
Sequence Length
259
Applicable Applications for anti-IRAK1BP1 antibody
Western Blot (WB)
Homology
Dog: 79%; Horse: 93%; Human: 100%; Mouse: 93%; Pig: 83%; Rabbit: 92%; Rat: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse Irak1bp1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: Irak1bp1Sample Type: Mouse Testis lysatesAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: Irak1bp1Sample Type: Mouse Testis lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-IRAK1BP1 antibody
This is a rabbit polyclonal antibody against Irak1bp1. It was validated on Western Blot

Target Description: Irak1bp1 is a component of the IRAK1-dependent TNFRSF1A signaling pathway that leads to NF-kappa-B activation and is required for cell survival. It acts by enhancing RELA transcriptional activity.
Product Categories/Family for anti-IRAK1BP1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
29kDa
NCBI Official Full Name
interleukin-1 receptor-associated kinase 1-binding protein 1 isoform 1
NCBI Official Synonym Full Names
interleukin-1 receptor-associated kinase 1 binding protein 1
NCBI Official Symbol
Irak1bp1
NCBI Official Synonym Symbols
Aabp3; Aip70; Simpl; AI851240; 4921528N06Rik
NCBI Protein Information
interleukin-1 receptor-associated kinase 1-binding protein 1
UniProt Protein Name
Interleukin-1 receptor-associated kinase 1-binding protein 1
UniProt Gene Name
Irak1bp1
UniProt Synonym Gene Names
Aip70; Simpl; IRAK1-binding protein 1; SIMPL
UniProt Entry Name
IKBP1_MOUSE

Uniprot Description

Function: Component of the IRAK1-dependent TNFRSF1A signaling pathway that leads to NF-kappa-B activation and is required for cell survival. Acts by enhancing RELA transcriptional activity. Ref.1 Ref.5

Subunit structure: Interacts with IRAK1 and RELA. Interacts with HSPA8 and HSPA1. May interact with Listeria monocytogenes actA. Ref.1 Ref.4 Ref.5 Ref.6

Subcellular location: Cytoplasm. Nucleus Ref.5.

Tissue specificity: Expressed in testis, brain, kidney, liver and heart. Ref.1

Developmental stage: Expression peaks at E10. Ref.1

Domain: The intrinsically disordered region interacts with HSPA1 and HSPA8.

Post-translational modification: Phosphorylation at Ser-55, Ser-61 and/or Ser-63 is required for full activity. Phosphorylated on at least one of Ser-234, Thr-236, Ser-241 and Thr-246 upon TNF-alpha activation, which favors nuclear translocation. Ref.7

Sequence similarities: Belongs to the IRAK1BP1 family.

Sequence caution: The sequence BAB32019.1 differs from that shown. Reason: Erroneous initiation.

Research Articles on IRAK1BP1

Similar Products

Product Notes

The IRAK1BP1 irak1bp1 (Catalog #AAA3215695) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Irak1bp1 Antibody - C-terminal region reacts with Dog, Horse, Human, Mouse, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's Irak1bp1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the IRAK1BP1 irak1bp1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: WEGQTDDHQL SRLPGTLTVQ QKIKSATIHA ASKVFITFEV KGKEKKKKHL. It is sometimes possible for the material contained within the vial of "Irak1bp1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.