Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunohistochemistry (IHC) (Rabbit Anti-THOC3 AntibodyParaffin Embedded Tissue: Human HeartCellular Data: Myocardial cellsAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)

Rabbit THOC3 Polyclonal Antibody | anti-THOC3 antibody

THOC3 antibody - middle region

Gene Names
THOC3; THO3; hTREX45
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Immunohistochemistry, Western Blot
Purity
Protein A purified
Synonyms
THOC3; Polyclonal Antibody; THOC3 antibody - middle region; anti-THOC3 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: PDGQTIAVGNKDDVVTFIDAKTHRSKAEEQFKFEVNEISWNNDNNMFFLT
Sequence Length
351
Applicable Applications for anti-THOC3 antibody
Immunohistochemistry (IHC), Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 86%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human THOC3
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Immunohistochemistry (IHC)

(Rabbit Anti-THOC3 AntibodyParaffin Embedded Tissue: Human HeartCellular Data: Myocardial cellsAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)

Immunohistochemistry (IHC) (Rabbit Anti-THOC3 AntibodyParaffin Embedded Tissue: Human HeartCellular Data: Myocardial cellsAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)

Immunohistochemistry (IHC)

(Rabbit Anti-THOC3 AntibodyParaffin Embedded Tissue: Human HeartCellular Data: Myocardial cellsAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)

Immunohistochemistry (IHC) (Rabbit Anti-THOC3 AntibodyParaffin Embedded Tissue: Human HeartCellular Data: Myocardial cellsAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)

Western Blot (WB)

(WB Suggested Anti-THOC3 Antibody Titration: 0.25ug/mlPositive Control: HepG2 cell lysate)

Western Blot (WB) (WB Suggested Anti-THOC3 Antibody Titration: 0.25ug/mlPositive Control: HepG2 cell lysate)
Related Product Information for anti-THOC3 antibody
This is a rabbit polyclonal antibody against THOC3. It was validated on Western Blot and immunohistochemistry

Target Description: THOC3 is part of the TREX (transcription/export) complex, which includes THO2, HPR1, ALY, and UAP56.TEX1 is part of the TREX (transcription/export) complex, which includes THO2 (MIM 300395), HPR1 (MIM 606930), ALY (MIM 604171), and UAP56 (MIM 606390).[supplied by OMIM].
Product Categories/Family for anti-THOC3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
39kDa
NCBI Official Full Name
THO complex subunit 3
NCBI Official Synonym Full Names
THO complex 3
NCBI Official Symbol
THOC3
NCBI Official Synonym Symbols
THO3; hTREX45
NCBI Protein Information
THO complex subunit 3
UniProt Protein Name
THO complex subunit 3
UniProt Gene Name
THOC3
UniProt Synonym Gene Names
Tho3
UniProt Entry Name
THOC3_HUMAN

NCBI Description

This gene encodes a component of the nuclear THO transcription elongation complex, which is part of the larger transcription export (TREX) complex that couples messenger RNA processing and export. In humans, the transcription export complex is recruited to the 5'-end of messenger RNAs in a splicing- and cap-dependent manner. Studies of a related complex in mouse suggest that the metazoan transcription export complex is involved in cell differentiation and development. A pseudogene of this gene has been defined on chromosome 5. [provided by RefSeq, May 2013]

Uniprot Description

Function: Component of the THO subcomplex of the TREX complex. The TREX complex specifically associates with spliced mRNA and not with unspliced pre-mRNA. It is recruited to spliced mRNAs by a transcription-independent mechanism. Binds to mRNA upstream of the exon-junction complex (EJC) and is recruited in a splicing- and cap-dependent manner to a region near the 5' end of the mRNA where it functions in mRNA export. The recruitment occurs via an interaction between ALYREF/THOC4 and the cap-binding protein NCBP1. DDX39B functions as a bridge between ALYREF/THOC4 and the THO complex. The TREX complex is essential for the export of Kaposi's sarcoma-associated herpesvirus (KSHV) intronless mRNAs and infectious virus production. The recruitment of the TREX complex to the intronless viral mRNA occurs via an interaction between KSHV ORF57 protein and ALYREF/THOC4. Ref.3 Ref.4 Ref.5 Ref.6 Ref.7

Subunit structure: Component of the THO complex, which is composed of THOC1, THOC2, THOC5, THOC6 and THOC7. Together with THOC3, ALYREF/THOC4 and DDX39B, THO forms the transcription/export (TREX) complex. Ref.4 Ref.5

Subcellular location: Nucleus

Probable.

Sequence similarities: Contains 6 WD repeats.

Caution: There are two almost identical copies of this gene on chromosome 5q35. One copy is frameshifted and unlikely to encode a functional protein.

Research Articles on THOC3

Similar Products

Product Notes

The THOC3 thoc3 (Catalog #AAA3205620) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The THOC3 antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's THOC3 can be used in a range of immunoassay formats including, but not limited to, Immunohistochemistry (IHC), Western Blot (WB). Researchers should empirically determine the suitability of the THOC3 thoc3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: PDGQTIAVGN KDDVVTFIDA KTHRSKAEEQ FKFEVNEISW NNDNNMFFLT. It is sometimes possible for the material contained within the vial of "THOC3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.