Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: THOC1Sample Type: ACHN Whole cell lysatesAntibody Dilution: 1.0ug/ml)

Rabbit THOC1 Polyclonal Antibody | anti-THOC1 antibody

THOC1 Antibody - C-terminal region

Gene Names
THOC1; P84; HPR1; P84N5
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
THOC1; Polyclonal Antibody; THOC1 Antibody - C-terminal region; anti-THOC1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: NEQESTLGQKHTEDREEGMDVEEGEMGDEEAPTTCSIPIDYNLYRKFWSL
Sequence Length
377
Applicable Applications for anti-THOC1 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 83%
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Human THOC1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: THOC1Sample Type: ACHN Whole cell lysatesAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: THOC1Sample Type: ACHN Whole cell lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-THOC1 antibody
This is a rabbit polyclonal antibody against THOC1. It was validated on Western Blot

Target Description: HPR1 is part of the TREX (transcription/export) complex, which includes TEX1 (MIM 606929), THO2 (MIM 300395), ALY (MIM 604171), and UAP56 (MIM 142560).[supplied by OMIM, Nov 2010]
Product Categories/Family for anti-THOC1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
41kDa
NCBI Official Full Name
THO complex subunit 1
NCBI Official Synonym Full Names
THO complex 1
NCBI Official Symbol
THOC1
NCBI Official Synonym Symbols
P84; HPR1; P84N5
NCBI Protein Information
THO complex subunit 1
UniProt Protein Name
THO complex subunit 1
UniProt Gene Name
THOC1
UniProt Synonym Gene Names
HPR1; Tho1; p84N5
UniProt Entry Name
THOC1_HUMAN

NCBI Description

HPR1 is part of the TREX (transcription/export) complex, which includes TEX1 (MIM 606929), THO2 (MIM 300395), ALY (MIM 604171), and UAP56 (MIM 142560).[supplied by OMIM, Nov 2010]

Uniprot Description

Tho1: a protein associated the nuclear matrix. Part of the TREX (transcription/export) complex. The TREX complex is recruited to transcribed genes and travels with the RNA polymerase during elongation. It may physically link proteins that function in transcription and in RNA export.

Protein type: Spliceosome

Chromosomal Location of Human Ortholog: 18p11.32

Cellular Component: nucleoplasm; intercellular bridge; nuclear matrix; cytoplasm; nuclear speck; nucleus

Molecular Function: protein binding; DNA binding; RNA binding

Biological Process: RNA processing; mRNA export from nucleus; transcription, DNA-dependent; negative regulation of isotype switching to IgA isotypes; apoptosis; RNA splicing; positive regulation of RNA elongation; regulation of DNA recombination; intronless viral mRNA export from host nucleus; signal transduction; mRNA processing; regulation of RNA elongation; replication fork processing

Research Articles on THOC1

Similar Products

Product Notes

The THOC1 thoc1 (Catalog #AAA3205332) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The THOC1 Antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's THOC1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the THOC1 thoc1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: NEQESTLGQK HTEDREEGMD VEEGEMGDEE APTTCSIPID YNLYRKFWSL. It is sometimes possible for the material contained within the vial of "THOC1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.