Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-THNSL2 Antibody Titration: 0.2-1 ug/mlPositive Control: HT1080 cell lysate)

Rabbit THNSL2 Polyclonal Antibody | anti-THNSL2 antibody

THNSL2 antibody - middle region

Gene Names
THNSL2; THS2; TSH2; SOFAT
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
THNSL2; Polyclonal Antibody; THNSL2 antibody - middle region; anti-THNSL2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: LPLVEVVVPTGAAGNLAAGYIAQKIGLPIRLVVAVNRNDIIHRTVQQGDF
Sequence Length
484
Applicable Applications for anti-THNSL2 antibody
Western Blot (WB)
Homology
Cow: 93%; Dog: 92%; Guinea Pig: 92%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 93%; Rabbit: 93%; Rat: 100%; Zebrafish: 80%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human THNSL2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-THNSL2 Antibody Titration: 0.2-1 ug/mlPositive Control: HT1080 cell lysate)

Western Blot (WB) (WB Suggested Anti-THNSL2 Antibody Titration: 0.2-1 ug/mlPositive Control: HT1080 cell lysate)
Related Product Information for anti-THNSL2 antibody
This is a rabbit polyclonal antibody against THNSL2. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: THNSL2 acts as a catabolic phospho-lyase on both gamma- and beta-phosphorylated substrates.THNSL2 dDegrades O-phospho-threonine (PThr) to alpha-ketobutyrate, ammonia and phosphate.
Product Categories/Family for anti-THNSL2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
54kDa
NCBI Official Full Name
threonine synthase-like 2 isoform 1
NCBI Official Synonym Full Names
threonine synthase like 2
NCBI Official Symbol
THNSL2
NCBI Official Synonym Symbols
THS2; TSH2; SOFAT
NCBI Protein Information
threonine synthase-like 2
UniProt Protein Name
Threonine synthase-like 2
Protein Family
UniProt Gene Name
THNSL2
UniProt Synonym Gene Names
TSH2; SOFAT
UniProt Entry Name
THNS2_HUMAN

NCBI Description

This gene encodes a threonine synthase-like protein. A similar enzyme in mouse can catalyze the degradation of O-phospho-homoserine to a-ketobutyrate, phosphate, and ammonia. This protein also has phospho-lyase activity on both gamma and beta phosphorylated substrates. In mouse an alternatively spliced form of this protein has been shown to act as a cytokine and can induce the production of the inflammatory cytokine IL6 in osteoblasts. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Sep 2011]

Uniprot Description

THNSL2: Isoform 1: Acts as a catabolic phospho-lyase on both gamma- and beta-phosphorylated substrates. Degrades O-phospho- threonine (PThr) to alpha-ketobutyrate, ammonia and phosphate. Belongs to the threonine synthase family. 5 isoforms of the human protein are produced by alternative splicing.

Protein type: EC 4.2.3.-; Lyase

Chromosomal Location of Human Ortholog: 2p11.2

Cellular Component: extracellular space; cytoplasm

Molecular Function: cytokine activity; threonine synthase activity; pyridoxal phosphate binding

Biological Process: dephosphorylation; 2-oxobutyrate biosynthetic process; threonine biosynthetic process; serine family amino acid catabolic process

Research Articles on THNSL2

Similar Products

Product Notes

The THNSL2 thnsl2 (Catalog #AAA3213223) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The THNSL2 antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's THNSL2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the THNSL2 thnsl2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: LPLVEVVVPT GAAGNLAAGY IAQKIGLPIR LVVAVNRNDI IHRTVQQGDF. It is sometimes possible for the material contained within the vial of "THNSL2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.