Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-SDCCAG8 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: THP-1 cell lysate)

Rabbit SDCCAG8 Polyclonal Antibody | anti-SDCCAG8 antibody

SDCCAG8 antibody - N-terminal region

Gene Names
SDCCAG8; BBS16; CCCAP; SLSN7; NPHP10; hCCCAP; HSPC085; NY-CO-8; CCCAP SLSN7
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
SDCCAG8; Polyclonal Antibody; SDCCAG8 antibody - N-terminal region; anti-SDCCAG8 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: HEETNMPTMHDLVHTINDQSQYIHHLEAEVKFCKEELSGMKNKIQVVVLE
Sequence Length
713
Applicable Applications for anti-SDCCAG8 antibody
Western Blot (WB)
Homology
Cow: 93%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 79%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human SDCCAG8
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-SDCCAG8 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: THP-1 cell lysate)

Western Blot (WB) (WB Suggested Anti-SDCCAG8 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: THP-1 cell lysate)
Related Product Information for anti-SDCCAG8 antibody
This is a rabbit polyclonal antibody against SDCCAG8. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: The exact function of SDCCAG8 remains unknown.
Product Categories/Family for anti-SDCCAG8 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
83kDa
NCBI Official Full Name
serologically defined colon cancer antigen 8 isoform 1
NCBI Official Synonym Full Names
serologically defined colon cancer antigen 8
NCBI Official Symbol
SDCCAG8
NCBI Official Synonym Symbols
BBS16; CCCAP; SLSN7; NPHP10; hCCCAP; HSPC085; NY-CO-8; CCCAP SLSN7
NCBI Protein Information
serologically defined colon cancer antigen 8
UniProt Protein Name
Serologically defined colon cancer antigen 8
UniProt Gene Name
SDCCAG8
UniProt Synonym Gene Names
CCCAP; NPHP10; hCCCAP
UniProt Entry Name
SDCG8_HUMAN

NCBI Description

This gene encodes a centrosome associated protein. This protein may be involved in organizing the centrosome during interphase and mitosis. Mutations in this gene are associated with retinal-renal ciliopathy. [provided by RefSeq, Oct 2010]

Uniprot Description

SDCCAG8: Plays a role in the establishment of cell polarity and epithelial lumen formation. May play a role in ciliogenesis. Defects in SDCCAG8 are the cause of Senior-Loken syndrome type 7 (SLSN7). SLSN7 is a renal-retinal disorder characterized by progressive wasting of the filtering unit of the kidney (nephronophthisis), with or without medullary cystic renal disease, and progressive eye disease. Typically this disorder becomes apparent during the first year of life. 4 isoforms of the human protein are produced by alternative splicing.

Protein type: Unknown function

Chromosomal Location of Human Ortholog: 1q43

Cellular Component: centriole; centrosome; intercellular junction; cytosol

Molecular Function: protein binding

Biological Process: establishment of cell polarity; organelle organization and biogenesis; lumen formation; mitotic cell cycle; G2/M transition of mitotic cell cycle

Disease: Bardet-biedl Syndrome 16; Bardet-biedl Syndrome 1; Senior-loken Syndrome 7

Research Articles on SDCCAG8

Similar Products

Product Notes

The SDCCAG8 sdccag8 (Catalog #AAA3210668) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SDCCAG8 antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's SDCCAG8 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the SDCCAG8 sdccag8 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: HEETNMPTMH DLVHTINDQS QYIHHLEAEV KFCKEELSGM KNKIQVVVLE. It is sometimes possible for the material contained within the vial of "SDCCAG8, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.