Rabbit anti-Human, Mouse Thioredoxin Domain-containing Protein 4 Polyclonal Antibody | anti-TXNDC4 antibody

Thioredoxin Domain-containing Protein 4 (TXNDC4, Endoplasmic Reticulum Resident Protein 44, ER Protein 44, ERp44, KIAA0573, PDIA10, UNQ532/PRO1075) (HRP)

Cat. Num. AAA6397703

• Gene Names: ERP44; PDIA10; TXNDC4
• Reactivity: Human, Mouse
• Applications: Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: Thioredoxin Domain-containing Protein 4; Polyclonal Antibody; Thioredoxin Domain-containing Protein 4 (TXNDC4; Endoplasmic Reticulum Resident Protein 44; ER Protein 44; ERp44; KIAA0573; PDIA10; UNQ532/PRO1075) (HRP); anti-TXNDC4 antibody

• Host: Rabbit
• Reactivity: Human, Mouse
• Clonality: Polyclonal
• Isotype: IgG
• Specificity: Recognizes human TXNDC4. Species Crossreactivity: mouse.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Horseradish Peroxidase (HRP).
• Sequence Length: 4862

• Applicable Applications for anti-TXNDC4 antibody: Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Full length human TXNDC4, aa1-406 (NP_055866.1).
• Immunogen Sequence: MHPAVFLSLPDLRCSLLLLVTWVFTPVTTEITSLDTENIDEILNNADVALVNFYADWCRFSQMLHPIFEEASDVIKEEFPNENQVVFARVDCDQHSDIAQRYRISKYPTLKLFRNGMMMKREYRGQRSVKALADYIRQQKSDPIQEIRDLAEITTLDRSKRNIIGYFEQKDSDNYRVFERVANILHDDCAFLSAFGDVSKPERYSGDNIIYKPPGHSAPDMVYLGAMTNFDVTYNWIQDKCVPLVREITFENGEELTEEGLPFLILFHMKEDTESLEIFQNEVARQLISEKGTINFLHADCDKFRHPLLHIQKTPADCPVIAIDSFRHMYVFGDFKDVLIPGKLKQFVFDLHSGKLHREFHHGPDPTDTAPGEQAQDVASSPPESSFQKLAPSEYRYTLLRDRDEL
• Conjugate: HRP
• Note: Preservative Free
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(TXNDC4 rabbit polyclonal antibody. Western Blot analysis of TXNDC4 expression in human liver.)

Western Blot (WB)

(TXNDC4 rabbit polyclonal antibody. Western Blot analysis of TXNDC4 expression in mouse liver.)

Western Blot (WB)

(TXNDC4 rabbit polyclonal antibody. Western Blot analysis of TXNDC4 expression in HepG2.)

Western Blot (WB)

(Western Blot analysis of TXNDC4 expression in transfected 293T cell line by TXNDC4 polyclonal antibody. Lane 1: TXNDC4 transfected lysate (47.0kD). Lane 2: Non-transfected lysate.)

Product Categories/Family for anti-TXNDC4 antibody

Antibodies; Thioredoxin

NCBI and Uniprot Product Information

• NCBI GI #: 52487190
• NCBI GeneID: 23071
• NCBI Accession #: NM_015051.1
• NCBI GenBank Nucleotide #: NM_015051.1
• UniProt Accession #: Q9BS26
• NCBI Official Full Name: Homo sapiens endoplasmic reticulum protein 44 (ERP44), mRNA
• NCBI Official Synonym Full Names: endoplasmic reticulum protein 44
• NCBI Official Symbol: ERP44
• NCBI Official Synonym Symbols: PDIA10; TXNDC4
• NCBI Protein Information: endoplasmic reticulum resident protein 44
• UniProt Protein Name: Endoplasmic reticulum resident protein 44
• UniProt Gene Name: ERP44
• UniProt Synonym Gene Names: KIAA0573; TXNDC4; ER protein 44; ERp44
• UniProt Entry Name: ERP44_HUMAN

NCBI Description

This gene encodes a member of the protein disulfide isomerase (PDI) family of endoplasmic reticulum (ER) proteins. It has an inferred N-terminal signal peptide, a catalytically active thioredoxin (TRX) domain, two TRX-like domains and a C-terminal ER-retention sequence. This protein functions as a pH-regulated chaperone of the secretory pathway and likely plays a role in protein quality control at the endoplasmic reticulum - Golgi interface. [provided by RefSeq, Dec 2016]

Uniprot Description

ERP44: Mediates thiol-dependent retention in the early secretory pathway, forming mixed disulfides with substrate proteins through its conserved CRFS motif. Inhibits the calcium channel activity of ITPR1. May have a role in the control of oxidative protein folding in the endoplasmic reticulum. Required to retain ERO1L and ERO1LB in the endoplasmic reticulum. Forms mixed disulfides with both ERO1L and ERO1LB and cargo folding intermediates. Directly interacts with ITPR1 in a pH-, redox state- and calcium-dependent manner, but not with ITPR2 or ITPR3. The strength of this interaction inversely correlates with calcium concentration. By endoplasmic reticulum stress.

Protein type: Secreted, signal peptide; Endoplasmic reticulum; Secreted; Isomerase

Chromosomal Location of Human Ortholog: 9q31.1

Cellular Component: endoplasmic reticulum membrane; cell surface; endoplasmic reticulum lumen; ER-Golgi intermediate compartment

Molecular Function: protein binding; protein disulfide isomerase activity

Biological Process: glycoprotein metabolic process; protein folding; cell redox homeostasis; response to unfolded protein