Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (37kD).)

Mouse anti-Human SNAP25 Monoclonal Antibody | anti-SNAP25 antibody

SNAP25 (SNAP25, Synaptosomal-Associated protein 25, SNAP-25, Synaptosomal-Associated 25kD Protein, SUP, Super Protein, SNAP, Synaptosomal-Associated Protein, 25kDa) (PE)

Gene Names
SNAP25; SUP; RIC4; SEC9; SNAP; CMS18; RIC-4; SNAP-25; bA416N4.2; dJ1068F16.2
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
SNAP25; Monoclonal Antibody; SNAP25 (SNAP25; Synaptosomal-Associated protein 25; SNAP-25; Synaptosomal-Associated 25kD Protein; SUP; Super Protein; SNAP; Synaptosomal-Associated Protein; 25kDa) (PE); anti-SNAP25 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
4A3
Specificity
Recognizes human SNAP25.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Applicable Applications for anti-SNAP25 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa31-130 from human SNA25 with GST tag. MW of the GST tag alone is 26kD.(AAH10647).
Immunogen Sequence
RMLQLVEESKDAGIRTLVMLDEQGEQLDRVEEGMNHINQDMKEAEKNLKDLGKCCGLFICPCNKLKSSDAYKKAWGNNQDGVVASQPARVVDEREQMAIS
Conjugate
PE
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37kD).)

Western Blot (WB) (Western Blot detection against Immunogen (37kD).)

Western Blot (WB)

(Western Blot analysis of SNAP25 expression in transfected 293T cell line by SNAP25 monoclonal antibody. Lane 1: SNAP25 transfected lysate (23.315kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of SNAP25 expression in transfected 293T cell line by SNAP25 monoclonal antibody. Lane 1: SNAP25 transfected lysate (23.315kD). Lane 2: Non-transfected lysate.)

Testing Data

(Detection limit for recombinant GST tagged SNAP25 is 0.03ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged SNAP25 is 0.03ng/ml as a capture antibody.)
Related Product Information for anti-SNAP25 antibody
SNAP25 (Synaptosomal associated protein of 25kD) is a presynaptic plasma membrane protein that is widely distributed throughout the brain and involved in the regulation of neurotransmitter release. Decreased levels of SNAP25 have been found in the brains of patients with Down Syndrome and Alzheimer's Disease (Greber et al.,1999). In addition, a significant reduction in the hippocampal expression of SNAP25 has also been found in patients with Schizophrenia (Fatemi et al., 2001).
Product Categories/Family for anti-SNAP25 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
23,336 Da
NCBI Official Full Name
Homo sapiens synaptosomal-associated protein, 25kDa, mRNA
NCBI Official Synonym Full Names
synaptosome associated protein 25
NCBI Official Symbol
SNAP25
NCBI Official Synonym Symbols
SUP; RIC4; SEC9; SNAP; CMS18; RIC-4; SNAP-25; bA416N4.2; dJ1068F16.2
NCBI Protein Information
synaptosomal-associated protein 25
Protein Family

NCBI Description

Synaptic vesicle membrane docking and fusion is mediated by SNAREs (soluble N-ethylmaleimide-sensitive factor attachment protein receptors) located on the vesicle membrane (v-SNAREs) and the target membrane (t-SNAREs). The assembled v-SNARE/t-SNARE complex consists of a bundle of four helices, one of which is supplied by v-SNARE and the other three by t-SNARE. For t-SNAREs on the plasma membrane, the protein syntaxin supplies one helix and the protein encoded by this gene contributes the other two. Therefore, this gene product is a presynaptic plasma membrane protein involved in the regulation of neurotransmitter release. Two alternative transcript variants encoding different protein isoforms have been described for this gene. [provided by RefSeq, Jul 2008]

Research Articles on SNAP25

Similar Products

Product Notes

The SNAP25 (Catalog #AAA6160399) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The SNAP25 (SNAP25, Synaptosomal-Associated protein 25, SNAP-25, Synaptosomal-Associated 25kD Protein, SUP, Super Protein, SNAP, Synaptosomal-Associated Protein, 25kDa) (PE) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's SNAP25 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the SNAP25 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "SNAP25, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.