Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (TXNDC4 rabbit polyclonal antibody. Western Blot analysis of TXNDC4 expression in human liver.)

Rabbit anti-Human, Mouse Thioredoxin Domain-containing Protein 4 Polyclonal Antibody | anti-TXNDC4 antibody

Thioredoxin Domain-containing Protein 4 (TXNDC4, Endoplasmic Reticulum Resident Protein 44, ER Protein 44, ERp44, KIAA0573, PDIA10, UNQ532/PRO1075) (FITC)

Gene Names
ERP44; PDIA10; TXNDC4
Reactivity
Human, Mouse
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
Thioredoxin Domain-containing Protein 4; Polyclonal Antibody; Thioredoxin Domain-containing Protein 4 (TXNDC4; Endoplasmic Reticulum Resident Protein 44; ER Protein 44; ERp44; KIAA0573; PDIA10; UNQ532/PRO1075) (FITC); anti-TXNDC4 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human TXNDC4. Species Crossreactivity: mouse.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein Isothiocyanate (FITC).
Sequence Length
4862
Applicable Applications for anti-TXNDC4 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human TXNDC4, aa1-406 (NP_055866.1).
Immunogen Sequence
MHPAVFLSLPDLRCSLLLLVTWVFTPVTTEITSLDTENIDEILNNADVALVNFYADWCRFSQMLHPIFEEASDVIKEEFPNENQVVFARVDCDQHSDIAQRYRISKYPTLKLFRNGMMMKREYRGQRSVKALADYIRQQKSDPIQEIRDLAEITTLDRSKRNIIGYFEQKDSDNYRVFERVANILHDDCAFLSAFGDVSKPERYSGDNIIYKPPGHSAPDMVYLGAMTNFDVTYNWIQDKCVPLVREITFENGEELTEEGLPFLILFHMKEDTESLEIFQNEVARQLISEKGTINFLHADCDKFRHPLLHIQKTPADCPVIAIDSFRHMYVFGDFKDVLIPGKLKQFVFDLHSGKLHREFHHGPDPTDTAPGEQAQDVASSPPESSFQKLAPSEYRYTLLRDRDEL
Conjugate
FITC
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(TXNDC4 rabbit polyclonal antibody. Western Blot analysis of TXNDC4 expression in human liver.)

Western Blot (WB) (TXNDC4 rabbit polyclonal antibody. Western Blot analysis of TXNDC4 expression in human liver.)

Western Blot (WB)

(TXNDC4 rabbit polyclonal antibody. Western Blot analysis of TXNDC4 expression in mouse liver.)

Western Blot (WB) (TXNDC4 rabbit polyclonal antibody. Western Blot analysis of TXNDC4 expression in mouse liver.)

Western Blot (WB)

(TXNDC4 rabbit polyclonal antibody. Western Blot analysis of TXNDC4 expression in HepG2.)

Western Blot (WB) (TXNDC4 rabbit polyclonal antibody. Western Blot analysis of TXNDC4 expression in HepG2.)

Western Blot (WB)

(Western Blot analysis of TXNDC4 expression in transfected 293T cell line by TXNDC4 polyclonal antibody. Lane 1: TXNDC4 transfected lysate (47.0kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of TXNDC4 expression in transfected 293T cell line by TXNDC4 polyclonal antibody. Lane 1: TXNDC4 transfected lysate (47.0kD). Lane 2: Non-transfected lysate.)
Product Categories/Family for anti-TXNDC4 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
Homo sapiens endoplasmic reticulum protein 44 (ERP44), mRNA
NCBI Official Synonym Full Names
endoplasmic reticulum protein 44
NCBI Official Symbol
ERP44
NCBI Official Synonym Symbols
PDIA10; TXNDC4
NCBI Protein Information
endoplasmic reticulum resident protein 44
UniProt Protein Name
Endoplasmic reticulum resident protein 44
UniProt Gene Name
ERP44
UniProt Synonym Gene Names
KIAA0573; TXNDC4; ER protein 44; ERp44
UniProt Entry Name
ERP44_HUMAN

NCBI Description

This gene encodes a member of the protein disulfide isomerase (PDI) family of endoplasmic reticulum (ER) proteins. It has an inferred N-terminal signal peptide, a catalytically active thioredoxin (TRX) domain, two TRX-like domains and a C-terminal ER-retention sequence. This protein functions as a pH-regulated chaperone of the secretory pathway and likely plays a role in protein quality control at the endoplasmic reticulum - Golgi interface. [provided by RefSeq, Dec 2016]

Uniprot Description

ERP44: Mediates thiol-dependent retention in the early secretory pathway, forming mixed disulfides with substrate proteins through its conserved CRFS motif. Inhibits the calcium channel activity of ITPR1. May have a role in the control of oxidative protein folding in the endoplasmic reticulum. Required to retain ERO1L and ERO1LB in the endoplasmic reticulum. Forms mixed disulfides with both ERO1L and ERO1LB and cargo folding intermediates. Directly interacts with ITPR1 in a pH-, redox state- and calcium-dependent manner, but not with ITPR2 or ITPR3. The strength of this interaction inversely correlates with calcium concentration. By endoplasmic reticulum stress.

Protein type: Secreted, signal peptide; Endoplasmic reticulum; Secreted; Isomerase

Chromosomal Location of Human Ortholog: 9q31.1

Cellular Component: endoplasmic reticulum membrane; cell surface; endoplasmic reticulum lumen; ER-Golgi intermediate compartment

Molecular Function: protein binding; protein disulfide isomerase activity

Biological Process: glycoprotein metabolic process; protein folding; cell redox homeostasis; response to unfolded protein

Research Articles on TXNDC4

Similar Products

Product Notes

The TXNDC4 erp44 (Catalog #AAA6397702) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Thioredoxin Domain-containing Protein 4 (TXNDC4, Endoplasmic Reticulum Resident Protein 44, ER Protein 44, ERp44, KIAA0573, PDIA10, UNQ532/PRO1075) (FITC) reacts with Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's Thioredoxin Domain-containing Protein 4 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the TXNDC4 erp44 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Thioredoxin Domain-containing Protein 4, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.