Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: MouseTarget Name: TGFB3Sample Tissue: Mouse Small IntestineAntibody Dilution: 1ug/ml)

Rabbit Tgfb3 Polyclonal Antibody | anti-TGFB3 antibody

Tgfb3 antibody - middle region

Gene Names
Tgfb3; TGF-B3
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
Tgfb3; Polyclonal Antibody; Tgfb3 antibody - middle region; anti-TGFB3 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration
0.5 mg/ml (varies by lot)
Sequence
Synthetic peptide located within the following region: ILRPDEHIAKQRYIGGKNLPTRGTAEWLSFDVTDTVREWLLRRESNLGLE
Sequence Length
412
Applicable Applications for anti-TGFB3 antibody
Western Blot (WB)
Protein Size (#AA)
412 amino acids
Homology
Cow: 92%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 92%; Zebrafish: 86%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: MouseTarget Name: TGFB3Sample Tissue: Mouse Small IntestineAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: MouseTarget Name: TGFB3Sample Tissue: Mouse Small IntestineAntibody Dilution: 1ug/ml)

Western Blot (WB)

(WB Suggested Anti-Tgfb3 AntibodyTitration: 1.0 ug/mlPositive Control: Rat Liver)

Western Blot (WB) (WB Suggested Anti-Tgfb3 AntibodyTitration: 1.0 ug/mlPositive Control: Rat Liver)
Related Product Information for anti-TGFB3 antibody
This is a rabbit polyclonal antibody against Tgfb3. It was validated on Western Blot

Target Description: Tgfb3 is involved in epithelial and endothelial cell proliferation and differentiation during development.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
45kDa
NCBI Official Full Name
transforming growth factor beta-3 proprotein preproprotein
NCBI Official Synonym Full Names
transforming growth factor, beta 3
NCBI Official Symbol
Tgfb3
NCBI Official Synonym Symbols
TGF-B3
NCBI Protein Information
transforming growth factor beta-3 proprotein; transforming growth factor beta-3
UniProt Protein Name
Transforming growth factor beta-3
UniProt Gene Name
Tgfb3
UniProt Synonym Gene Names
Tgf-b3; TGF-beta-3; LAP
UniProt Entry Name
TGFB3_RAT

NCBI Description

involved in epithelial and endothelial cell proliferation and differentiation during development [RGD, Feb 2006]

Uniprot Description

TGFB3: Involved in embryogenesis and cell differentiation

Protein type: Cell development/differentiation; Ligand, receptor tyrosine kinase; Motility/polarity/chemotaxis; Secreted; Secreted, signal peptide

Cellular Component: cell soma; cell surface; cytoplasm; extracellular matrix; extracellular space; nucleus; proteinaceous extracellular matrix; secretory granule; T-tubule

Molecular Function: cytokine activity; identical protein binding; protein heterodimerization activity; punt binding; transforming growth factor beta binding; transforming growth factor beta receptor binding

Biological Process: activation of MAPK activity; aging; alveolus development; cell development; embryonic neurocranium morphogenesis; female pregnancy; gut development; in utero embryonic development; inner ear development; intercellular junction assembly and maintenance; mammary gland development; negative regulation of cell proliferation; negative regulation of DNA replication; negative regulation of neuron apoptosis; negative regulation of transforming growth factor beta receptor signaling pathway; organ morphogenesis; palate development; positive regulation of apoptosis; positive regulation of bone mineralization; positive regulation of collagen biosynthetic process; positive regulation of DNA replication; positive regulation of filopodium formation; positive regulation of protein secretion; positive regulation of transcription from RNA polymerase II promoter; positive regulation of transcription, DNA-dependent; regulation of endothelial cell differentiation; regulation of epithelial cell differentiation; regulation of epithelial cell proliferation; response to estrogen stimulus; response to hypoxia; response to progesterone stimulus; salivary gland morphogenesis; SMAD protein nuclear translocation; transforming growth factor beta receptor signaling pathway; wound healing

Research Articles on TGFB3

Similar Products

Product Notes

The TGFB3 tgfb3 (Catalog #AAA3207763) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Tgfb3 antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's Tgfb3 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the TGFB3 tgfb3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: ILRPDEHIAK QRYIGGKNLP TRGTAEWLSF DVTDTVREWL LRRESNLGLE. It is sometimes possible for the material contained within the vial of "Tgfb3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.