Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunohistochemistry (IHC) (Rabbit Anti-TGFB3 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Heart TissueObserved Staining: Cytoplasm in cardiomyocytesPrimary Antibody Concentration: 1:100Other Working Concentrations: N/ASecondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)

Rabbit TGFB3 Polyclonal Antibody | anti-TGFB3 antibody

TGFB3 antibody - middle region

Gene Names
TGFB3; ARVD; LDS5; RNHF; ARVD1; TGF-beta3
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep
Applications
Western Blot, Immunohistochemistry
Purity
Affinity Purified
Synonyms
TGFB3; Polyclonal Antibody; TGFB3 antibody - middle region; anti-TGFB3 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: EFRVLRVPNPSSKRNEQRIELFQILRPDEHIAKQRYIGGKNLPTRGTAEW
Sequence Length
412
Applicable Applications for anti-TGFB3 antibody
Western Blot (WB), Immunohistochemistry (IHC)
Homology
Cow: 85%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 93%; Rabbit: 100%; Rat: 93%; Sheep: 85%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human TGFB3
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Immunohistochemistry (IHC)

(Rabbit Anti-TGFB3 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Heart TissueObserved Staining: Cytoplasm in cardiomyocytesPrimary Antibody Concentration: 1:100Other Working Concentrations: N/ASecondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)

Immunohistochemistry (IHC) (Rabbit Anti-TGFB3 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Heart TissueObserved Staining: Cytoplasm in cardiomyocytesPrimary Antibody Concentration: 1:100Other Working Concentrations: N/ASecondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)

Western Blot (WB)

(WB Suggested Anti-TGFB3 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Jurkat cell lysate)

Western Blot (WB) (WB Suggested Anti-TGFB3 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Jurkat cell lysate)
Related Product Information for anti-TGFB3 antibody
This is a rabbit polyclonal antibody against TGFB3. It was validated on Western Blot

Target Description: TGFB3 is involved in embryogenesis and cell differentiation.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
47kDa
NCBI Official Full Name
transforming growth factor beta-3 proprotein isoform 1 preproprotein
NCBI Official Synonym Full Names
transforming growth factor beta 3
NCBI Official Symbol
TGFB3
NCBI Official Synonym Symbols
ARVD; LDS5; RNHF; ARVD1; TGF-beta3
NCBI Protein Information
transforming growth factor beta-3 proprotein
UniProt Protein Name
Transforming growth factor beta-3
UniProt Gene Name
TGFB3
UniProt Synonym Gene Names
TGF-beta-3; LAP
UniProt Entry Name
TGFB3_HUMAN

NCBI Description

This gene encodes a secreted ligand of the TGF-beta (transforming growth factor-beta) superfamily of proteins. Ligands of this family bind various TGF-beta receptors leading to recruitment and activation of SMAD family transcription factors that regulate gene expression. The encoded preproprotein is proteolytically processed to generate a latency-associated peptide (LAP) and a mature peptide, and is found in either a latent form composed of a mature peptide homodimer, a LAP homodimer, and a latent TGF-beta binding protein, or in an active form consisting solely of the mature peptide homodimer. The mature peptide may also form heterodimers with other TGF-beta family members. This protein is involved in embryogenesis and cell differentiation, and may play a role in wound healing. Mutations in this gene are a cause of aortic aneurysms and dissections, as well as familial arrhythmogenic right ventricular dysplasia 1. [provided by RefSeq, Aug 2016]

Uniprot Description

TGFB3: Involved in embryogenesis and cell differentiation. Homodimer; disulfide-linked. Interacts with ASPN. Belongs to the TGF-beta family.

Protein type: Cell development/differentiation; Motility/polarity/chemotaxis; Ligand, receptor tyrosine kinase; Secreted, signal peptide; Secreted

Chromosomal Location of Human Ortholog: 14q24

Cellular Component: extracellular matrix; extracellular space; cell surface; cell soma; T-tubule; extracellular region; plasma membrane; nucleus

Molecular Function: identical protein binding; protein binding; growth factor activity; transforming growth factor beta binding; protein heterodimerization activity; punt binding; cytokine activity

Biological Process: extracellular matrix organization and biogenesis; positive regulation of apoptosis; activation of MAPK activity; positive regulation of transcription, DNA-dependent; positive regulation of collagen biosynthetic process; female pregnancy; SMAD protein nuclear translocation; palate development; odontogenesis; regulation of apoptosis; negative regulation of cell proliferation; platelet degranulation; mammary gland development; transforming growth factor beta receptor signaling pathway; salivary gland morphogenesis; embryonic neurocranium morphogenesis; negative regulation of neuron apoptosis; cell growth; inner ear development; aging; positive regulation of filopodium formation; uterine wall breakdown; intercellular junction assembly and maintenance; platelet activation; in utero embryonic development; positive regulation of bone mineralization; regulation of cell proliferation; positive regulation of protein secretion; gut development; negative regulation of DNA replication; response to estrogen stimulus; regulation of MAPKKK cascade; positive regulation of cell division; response to hypoxia; positive regulation of transcription from RNA polymerase II promoter; response to progesterone stimulus; blood coagulation; negative regulation of transforming growth factor beta receptor signaling pathway; alveolus development; positive regulation of DNA replication

Disease: Arrhythmogenic Right Ventricular Dysplasia, Familial, 1; Rienhoff Syndrome

Research Articles on TGFB3

Similar Products

Product Notes

The TGFB3 tgfb3 (Catalog #AAA3214206) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TGFB3 antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep and may cross-react with other species as described in the data sheet. AAA Biotech's TGFB3 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB), Immunohistochemistry (IHC). Researchers should empirically determine the suitability of the TGFB3 tgfb3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: EFRVLRVPNP SSKRNEQRIE LFQILRPDEH IAKQRYIGGK NLPTRGTAEW. It is sometimes possible for the material contained within the vial of "TGFB3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.